(data stored in ACNUC7421 zone)

EMBL: CP002116.PE225

CP002116.PE225       Location/Qualifiers
FT   CDS             232869..233420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP0584 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79385"
FT                   /db_xref="InterPro:IPR025191"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA94"
FT                   /protein_id="ADK79385.1"
FT                   /translation="MDQAQKRIIAEILDREVAMFLRVPARQEPSCRAHLDDMQLHRRGQ
FT                   FSVWSLSCCESYLRDLRRAEEEGRNLMTIKYARMEDLIPPVSQSKRIPEIVSRFVGWQR
FT                   EMLSHYPNIMRGGRDIDDFANYLRCELETYSDATLELLWKDVDAFSRKKQNMSKAIYEF
FT                   LARQSGYTNIDEMEKRLKKS"
     MDQAQKRIIA EILDREVAMF LRVPARQEPS CRAHLDDMQL HRRGQFSVWS LSCCESYLRD        60
     LRRAEEEGRN LMTIKYARME DLIPPVSQSK RIPEIVSRFV GWQREMLSHY PNIMRGGRDI       120
     DDFANYLRCE LETYSDATLE LLWKDVDAFS RKKQNMSKAI YEFLARQSGY TNIDEMEKRL       180
     KKS                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page