(data stored in ACNUC7421 zone)

EMBL: CP002116.PE226

CP002116.PE226       Location/Qualifiers
FT   CDS             233632..234588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0229"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="COGs: COG1879 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR001761; KEGG:
FT                   monosacharide ABC transporter periplasmic
FT                   monosacharide-binding protein; PFAM: periplasmic binding
FT                   protein/LacI transcriptional regulator; SPTR: ABC
FT                   transporter, periplasmic sugar binding protein; PFAM:
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79386"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA95"
FT                   /protein_id="ADK79386.1"
FT                   /translation="MSKKLLVLVLTAMLIPAGFLFSAGQQDGGEASNLMVIITPDKDNT
FT                   FFTAEADAAKAKAESLGYTTLLAVHGDDPKKEGDIIDTAIARKAVAIIIDVANADASPN
FT                   NLKRATDAGIPVFCMDREINATGIAKAQLISNNFQGAKLGGEYFVQVMGEKGNYVELVG
FT                   KESDTNAGVRSKGFHNIIDQYPDMKMVARQTANWSQTEGYSVIESVLQANPEVNGIICG
FT                   NDTMALGAQAAIDAAGRSDIIVIGFDGNDNVLDSIMEGKIEGTVMQPNAKNAEMAVELA
FT                   DTYIKTGSTGLDEEKILNDCFLITKENASQWRGFRKK"
     MSKKLLVLVL TAMLIPAGFL FSAGQQDGGE ASNLMVIITP DKDNTFFTAE ADAAKAKAES        60
     LGYTTLLAVH GDDPKKEGDI IDTAIARKAV AIIIDVANAD ASPNNLKRAT DAGIPVFCMD       120
     REINATGIAK AQLISNNFQG AKLGGEYFVQ VMGEKGNYVE LVGKESDTNA GVRSKGFHNI       180
     IDQYPDMKMV ARQTANWSQT EGYSVIESVL QANPEVNGII CGNDTMALGA QAAIDAAGRS       240
     DIIVIGFDGN DNVLDSIMEG KIEGTVMQPN AKNAEMAVEL ADTYIKTGST GLDEEKILND       300
     CFLITKENAS QWRGFRKK                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page