(data stored in ACNUC7421 zone)

EMBL: CP002116.PE227

CP002116.PE227       Location/Qualifiers
FT   CDS             234682..235380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0230"
FT                   /product="periplasmic lipoprotein"
FT                   /note="COGs: COG5618 periplasmic lipoprotein; InterPro
FT                   IPR014582; KEGG: acr:Acry_1065 periplasmic lipoprotein-like
FT                   protein; PFAM: periplasmic lipoprotein; SPTR: Periplasmic
FT                   lipoprotein-like protein; PFAM: Predicted periplasmic
FT                   lipoprotein (DUF2291)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79387"
FT                   /db_xref="InterPro:IPR014582"
FT                   /db_xref="InterPro:IPR036215"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA96"
FT                   /protein_id="ADK79387.1"
FT                   /translation="MMMRERTLCSFVMLLIGIAVLLSGCTIKKISELDEQQGDEYSTWT
FT                   KSGKAFDPVAYVDSIWDTKLIPAFKEESCDFETLLAALKKDPETATQEYGLMSKAGGMG
FT                   VTFKITGSARVVSYDDSSRNGLLLLDTPPYEGTVDAKMQVGPVIRNTAIRDSVSFIRFT
FT                   EVGNQLQFASLADELNARMKKEAVEPLDLSSIAGKEINYYGAFKLEDDDSLDDVVITPV
FT                   IIEPTIAGGA"
     MMMRERTLCS FVMLLIGIAV LLSGCTIKKI SELDEQQGDE YSTWTKSGKA FDPVAYVDSI        60
     WDTKLIPAFK EESCDFETLL AALKKDPETA TQEYGLMSKA GGMGVTFKIT GSARVVSYDD       120
     SSRNGLLLLD TPPYEGTVDA KMQVGPVIRN TAIRDSVSFI RFTEVGNQLQ FASLADELNA       180
     RMKKEAVEPL DLSSIAGKEI NYYGAFKLED DDSLDDVVIT PVIIEPTIAG GA               232
//

If you have problems or comments...

PBIL Back to PBIL home page