(data stored in ACNUC7421 zone)

EMBL: CP002116.PE228

CP002116.PE228       Location/Qualifiers
FT   CDS             235382..236935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0231"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1129 ABC-type sugar transport system ATPase
FT                   component; InterPro IPR003593:IPR003439:IPR017871; KEGG:
FT                   mlo:mll7012 ribose ABC transporter, ATP-binding protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR: ABC
FT                   transporter related protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79388"
FT                   /db_xref="GOA:E1RA97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA97"
FT                   /protein_id="ADK79388.1"
FT                   /translation="MAEEQSEVVLEARNITKVFPGTRALQGVDFKVYKGKINVLVGENG
FT                   AGKSTLMKILAGIEEATSGTICLFDNEGTPHEVTLSSARDAAGKGIGIVHQELNLFTNL
FT                   NVAENIFMNKELSRHHSLYIDHQEQVERSRTILKRLGQDIDPETLVRDLRLGQQQIVEI
FT                   AKTMIDEPKILIMDEPTSSLSIQEVRVLFNVIADLKAQGVGIIYISHRLEEIREIGDYI
FT                   TILRDSKLVDCGLVAEMEMADIIRKMVGRDPKKFFSGQAHEAGKELLSVKHMTLPRFGG
FT                   GYTFQDVSLSVCEGEILGIYGLMGAGRTELLETMMGLYDKASGEITLEGQRLDTMDTKE
FT                   RIEHGLVLIPEERQREGLFLNLSVEKNLTMASIARYLKLWQINVKVEMKRVAEMIKEMV
FT                   IKVSSPSISINALSGGNQQKVVIGKALLTKPKVLLMDEPTRGIDVGAKSDVFEIMNKMA
FT                   KGKFGIVFVSSELEEIFSMSDRIIVLSKGKITGEFDRSEATEEKIRKASEIGHGITASA
FT                   "
     MAEEQSEVVL EARNITKVFP GTRALQGVDF KVYKGKINVL VGENGAGKST LMKILAGIEE        60
     ATSGTICLFD NEGTPHEVTL SSARDAAGKG IGIVHQELNL FTNLNVAENI FMNKELSRHH       120
     SLYIDHQEQV ERSRTILKRL GQDIDPETLV RDLRLGQQQI VEIAKTMIDE PKILIMDEPT       180
     SSLSIQEVRV LFNVIADLKA QGVGIIYISH RLEEIREIGD YITILRDSKL VDCGLVAEME       240
     MADIIRKMVG RDPKKFFSGQ AHEAGKELLS VKHMTLPRFG GGYTFQDVSL SVCEGEILGI       300
     YGLMGAGRTE LLETMMGLYD KASGEITLEG QRLDTMDTKE RIEHGLVLIP EERQREGLFL       360
     NLSVEKNLTM ASIARYLKLW QINVKVEMKR VAEMIKEMVI KVSSPSISIN ALSGGNQQKV       420
     VIGKALLTKP KVLLMDEPTR GIDVGAKSDV FEIMNKMAKG KFGIVFVSSE LEEIFSMSDR       480
     IIVLSKGKIT GEFDRSEATE EKIRKASEIG HGITASA                                517
//

If you have problems or comments...

PBIL Back to PBIL home page