(data stored in ACNUC7421 zone)

EMBL: CP002116.PE229

CP002116.PE229       Location/Qualifiers
FT   CDS             236913..238043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0232"
FT                   /product="inner-membrane translocator"
FT                   /note="COGs: COG1172 Ribose/xylose/arabinose/galactoside
FT                   ABC-type transport systems permease components; InterPro
FT                   IPR001851; KEGG: sme:SM_b20352 sugar ABC transporter
FT                   permease protein; PFAM: inner-membrane translocator; SPTR:
FT                   ABC transporter, permease; PFAM: Branched-chain amino acid
FT                   transport system / permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79389"
FT                   /db_xref="GOA:E1RA98"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1RA98"
FT                   /protein_id="ADK79389.1"
FT                   /translation="MESPRQRSTGRLKKRFMTALANKKPGTGFSIGMLVLKLRTLIAFL
FT                   AVLIVFSFIAPNFLSITNLIAMAKHSAIWAILAVGMTYVIIGGGIDLSIGSIVGLCGMI
FT                   AGGLIAEGLRLPIFGIVIYFNVPMIILIVLLIGVLLGAVNGLIITKLGVAPFIATLGML
FT                   YMGRGFAMLRSGGKTFPNLIGNPALGNTGFPILGAGTMLGIPLVVWIAAVIAIIAAYVS
FT                   QKTPFGRHIYAVGGNEDAAVLSGIRVNRLKMAIFMFSGFTAALTGLVLASQLVASHPAT
FT                   GEAYEMTAIAAVVLGGASLNGGRGSIGGTIIGALILGVLNDGLVMIGVSSFWQTAIKGM
FT                   VLVLAVVIDQYQLRKQNEAALHQQQADEKGPEKVSA"
     MESPRQRSTG RLKKRFMTAL ANKKPGTGFS IGMLVLKLRT LIAFLAVLIV FSFIAPNFLS        60
     ITNLIAMAKH SAIWAILAVG MTYVIIGGGI DLSIGSIVGL CGMIAGGLIA EGLRLPIFGI       120
     VIYFNVPMII LIVLLIGVLL GAVNGLIITK LGVAPFIATL GMLYMGRGFA MLRSGGKTFP       180
     NLIGNPALGN TGFPILGAGT MLGIPLVVWI AAVIAIIAAY VSQKTPFGRH IYAVGGNEDA       240
     AVLSGIRVNR LKMAIFMFSG FTAALTGLVL ASQLVASHPA TGEAYEMTAI AAVVLGGASL       300
     NGGRGSIGGT IIGALILGVL NDGLVMIGVS SFWQTAIKGM VLVLAVVIDQ YQLRKQNEAA       360
     LHQQQADEKG PEKVSA                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page