(data stored in ACNUC7421 zone)

EMBL: CP002116.PE23

CP002116.PE23        Location/Qualifiers
FT   CDS             complement(19760..20260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0023"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppu:PP_0636 cold shock DNA-binding
FT                   domain-containing protein; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79183"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q1"
FT                   /protein_id="ADK79183.1"
FT                   /translation="MKKYTIMFIIAAGMVFSSGSTLFAEGAQEDEDFRDNPYQTVTVSG
FT                   KIYASFSGFPELKGDDGKTYRLMFPMFLADSLELSNGESVSVEGFSAPANWRPTRNPSD
FT                   AVYLRLVKATIDGQTYDLSRFYGHMGPGGPGRFHEGWGCFESGYDDSNHMVPAPGMGGY
FT                   RRR"
     MKKYTIMFII AAGMVFSSGS TLFAEGAQED EDFRDNPYQT VTVSGKIYAS FSGFPELKGD        60
     DGKTYRLMFP MFLADSLELS NGESVSVEGF SAPANWRPTR NPSDAVYLRL VKATIDGQTY       120
     DLSRFYGHMG PGGPGRFHEG WGCFESGYDD SNHMVPAPGM GGYRRR                      166
//

If you have problems or comments...

PBIL Back to PBIL home page