(data stored in ACNUC7421 zone)

EMBL: CP002116.PE231

CP002116.PE231       Location/Qualifiers
FT   CDS             239390..240028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0234"
FT                   /product="YheO domain protein"
FT                   /note="COGs: COG2964 conserved hypothetical protein;
FT                   InterPro IPR013559; KEGG: aoe:Clos_1744 YheO
FT                   domain-containing protein; PFAM: YheO domain protein; SPTR:
FT                   Putative uncharacterized protein; manually curated; PFAM:
FT                   YheO-like PAS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79391"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA0"
FT                   /protein_id="ADK79391.1"
FT                   /translation="MNKNEAFEFLNRLAAGIAKTFGNSCETVVHDMNNKKHSILVIYNG
FT                   HVTKRKIGGGLDLLGTNKQINDFLSNGSDLINCDGRSANGKQIKSTTLHLQGDNYHYAL
FT                   GINFDYTLLSVAENAIKELTRVGENLEAAVKESGENRLKDIFKECVTILGKPVAIMNKD
FT                   DRMRIVALLQERNAFSFQKSIPCISAWLHISRYTIYNYLKEINEKQRTG"
     MNKNEAFEFL NRLAAGIAKT FGNSCETVVH DMNNKKHSIL VIYNGHVTKR KIGGGLDLLG        60
     TNKQINDFLS NGSDLINCDG RSANGKQIKS TTLHLQGDNY HYALGINFDY TLLSVAENAI       120
     KELTRVGENL EAAVKESGEN RLKDIFKECV TILGKPVAIM NKDDRMRIVA LLQERNAFSF       180
     QKSIPCISAW LHISRYTIYN YLKEINEKQR TG                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page