(data stored in ACNUC7421 zone)

EMBL: CP002116.PE232

CP002116.PE232       Location/Qualifiers
FT   CDS             complement(240080..240751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0235"
FT                   /product="YheO domain protein"
FT                   /note="COGs: COG2964 conserved hypothetical protein;
FT                   InterPro IPR013559; KEGG: dvl:Dvul_1030 YheO
FT                   domain-containing protein; PFAM: YheO domain protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: YheO-like PAS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79392"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA1"
FT                   /protein_id="ADK79392.1"
FT                   /translation="MRDTIRNYLPIVQFLGSVLGSYYEIILIELKDEGSGIVAIENSHI
FT                   SGRKIGDGLTDLCLRFIKEETYKDTSFKSNYTCISNGRKLRGSTYFIKEGDMLVGMLCI
FT                   NFDTETFIELDTRLLQFANIQAQGIIDTLFPPQGVPDNNTETVLSSVTELCEQEVRKYA
FT                   EKNKLDAKKFTQENRIEIIEHLNNLGIFLIKGIVPDVANLIGTSEASVYRYLSIVNRKK
FT                   K"
     MRDTIRNYLP IVQFLGSVLG SYYEIILIEL KDEGSGIVAI ENSHISGRKI GDGLTDLCLR        60
     FIKEETYKDT SFKSNYTCIS NGRKLRGSTY FIKEGDMLVG MLCINFDTET FIELDTRLLQ       120
     FANIQAQGII DTLFPPQGVP DNNTETVLSS VTELCEQEVR KYAEKNKLDA KKFTQENRIE       180
     IIEHLNNLGI FLIKGIVPDV ANLIGTSEAS VYRYLSIVNR KKK                         223
//

If you have problems or comments...

PBIL Back to PBIL home page