(data stored in ACNUC7421 zone)

EMBL: CP002116.PE234

CP002116.PE234       Location/Qualifiers
FT   CDS             242546..244480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0237"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit; InterPro IPR006076; KEGG:
FT                   str:Sterm_3522 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; PFAM: FAD dependent oxidoreductase; SPTR:
FT                   Predicted protein; PFAM: domain; FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79394"
FT                   /db_xref="GOA:E1RAA3"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA3"
FT                   /protein_id="ADK79394.1"
FT                   /translation="MFSMKWPYPIECNQEERVKTDVLVIGGGISGCMAAISAAKQGAKV
FT                   ALLEKGATIRSGAGGSGCDHWESATTNPCSTVSPEEITQAMIDDNDGYNNGISHYIECR
FT                   EGWDCLREIEKMGGKIRDTEDEFLGADFRDPETKLMFAYDLKNKFTIRIWGSTFKPVLY
FT                   KELKRLGVKIYDRIMVTSLLTEGGEIGKRVIGCTGFHVRTGKHLVVSSKATVLATSRPA
FT                   RIWLFSPAYPGLCEFRPTQCVGDGHAMGWRAGAAFSMMEKSVTAEFSAAGRSFPPYGTG
FT                   NNHNTWYPASMCDARGKPIPYLDRDGKELKEFSDRYRPAAGQQYFLKGGSIDYPKYEYD
FT                   GPETIDQKKLLSMGYKLPFYADLTTMPELERKAIWGMMVGEEGKTKIPIYQNYTERGFD
FT                   PTRHVLQAYGGGWKSASFLPQERQLFGLPGGFLNDWNLATNLEGLFVAGDALFASNCFG
FT                   HAAATGSYAGRHASAYAKNVQHLVPCEKQIAKERSRTYASLGAEGQERYSWKELNMAIA
FT                   KTMQNYCGDPKCDDLLETGLDVFRHYETNILPHLYSRNPHELMRTLEVENILTNAQIIL
FT                   RSCLQRKSSSRALCFNRADYPEMDPERDRRFFTIRLTKSGVDMGSVPLRYYGDLSRNYE
FT                   KYNGNYIAE"
     MFSMKWPYPI ECNQEERVKT DVLVIGGGIS GCMAAISAAK QGAKVALLEK GATIRSGAGG        60
     SGCDHWESAT TNPCSTVSPE EITQAMIDDN DGYNNGISHY IECREGWDCL REIEKMGGKI       120
     RDTEDEFLGA DFRDPETKLM FAYDLKNKFT IRIWGSTFKP VLYKELKRLG VKIYDRIMVT       180
     SLLTEGGEIG KRVIGCTGFH VRTGKHLVVS SKATVLATSR PARIWLFSPA YPGLCEFRPT       240
     QCVGDGHAMG WRAGAAFSMM EKSVTAEFSA AGRSFPPYGT GNNHNTWYPA SMCDARGKPI       300
     PYLDRDGKEL KEFSDRYRPA AGQQYFLKGG SIDYPKYEYD GPETIDQKKL LSMGYKLPFY       360
     ADLTTMPELE RKAIWGMMVG EEGKTKIPIY QNYTERGFDP TRHVLQAYGG GWKSASFLPQ       420
     ERQLFGLPGG FLNDWNLATN LEGLFVAGDA LFASNCFGHA AATGSYAGRH ASAYAKNVQH       480
     LVPCEKQIAK ERSRTYASLG AEGQERYSWK ELNMAIAKTM QNYCGDPKCD DLLETGLDVF       540
     RHYETNILPH LYSRNPHELM RTLEVENILT NAQIILRSCL QRKSSSRALC FNRADYPEMD       600
     PERDRRFFTI RLTKSGVDMG SVPLRYYGDL SRNYEKYNGN YIAE                        644
//

If you have problems or comments...

PBIL Back to PBIL home page