(data stored in ACNUC7421 zone)

EMBL: CP002116.PE235

CP002116.PE235       Location/Qualifiers
FT   CDS             244485..244781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0238"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="InterPro IPR001450:IPR017896:IPR017900; KEGG:
FT                   ckr:CKR_2705 hypothetical protein; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: Predicted
FT                   protein; PFAM: 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79395"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA4"
FT                   /protein_id="ADK79395.1"
FT                   /translation="MNIENICAGPDIASIEPISFNTERCIACNRCADVCQVDVLVPSLE
FT                   KGKPPLVLFPGECWYCGCCVMECPTHAIQLRHPLMNQAHFRLKKELEDTLESE"
     MNIENICAGP DIASIEPISF NTERCIACNR CADVCQVDVL VPSLEKGKPP LVLFPGECWY        60
     CGCCVMECPT HAIQLRHPLM NQAHFRLKKE LEDTLESE                                98
//

If you have problems or comments...

PBIL Back to PBIL home page