(data stored in ACNUC7421 zone)

EMBL: CP002116.PE237

CP002116.PE237       Location/Qualifiers
FT   CDS             complement(245963..247480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0240"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR016047; KEGG:
FT                   eat:EAT1b_0890 peptidase M23; PFAM: Peptidase M23; SPTR:
FT                   Peptidase M23; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79397"
FT                   /db_xref="GOA:E1RAA6"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA6"
FT                   /protein_id="ADK79397.1"
FT                   /translation="MKGRYSKRQMEERLELLTEQIIHTLLARLGTGRASSSKPVKCQVN
FT                   GLIPGTYTLSMVRINPKELLLQELVSTKTRGNVIFRSWTFRKEEKWYVAGMEKLGKPVF
FT                   YRSIGQDLADLVRRNDTVSAVEASEGMYLVETAERAARNLGVELPSDYELKRNGLYPKS
FT                   IRFLTKHSALVAVLLIAVGIGTILGLYALKIGSIESEMNKSVKAYTANIDDQVKSFLDD
FT                   TEDEILGLINDVEKNRKNFEFDKRNAYLNVQRLAEELTRYTPARKRAYRLIADNILQST
FT                   TYSEIMYEMSRLPTEEYQARIFLATNRQSVIPLASFTPAIPGMLYPVRVDGENNDGRGF
FT                   RITDGYMDRRENPLGTGGSSPHFAVDIINVSNIAYVSHAGEIIREGNPPGDVVAVAPGA
FT                   ICDTGWDDGYGWYIEINHGISDEVKALYPDAERWCSYYAHLDEKPTQAIGTKVEADALI
FT                   GHIGNTGRSTGPHLHFEVRIYHKNGSYRSGDARYDKINPYPAERQEE"
     MKGRYSKRQM EERLELLTEQ IIHTLLARLG TGRASSSKPV KCQVNGLIPG TYTLSMVRIN        60
     PKELLLQELV STKTRGNVIF RSWTFRKEEK WYVAGMEKLG KPVFYRSIGQ DLADLVRRND       120
     TVSAVEASEG MYLVETAERA ARNLGVELPS DYELKRNGLY PKSIRFLTKH SALVAVLLIA       180
     VGIGTILGLY ALKIGSIESE MNKSVKAYTA NIDDQVKSFL DDTEDEILGL INDVEKNRKN       240
     FEFDKRNAYL NVQRLAEELT RYTPARKRAY RLIADNILQS TTYSEIMYEM SRLPTEEYQA       300
     RIFLATNRQS VIPLASFTPA IPGMLYPVRV DGENNDGRGF RITDGYMDRR ENPLGTGGSS       360
     PHFAVDIINV SNIAYVSHAG EIIREGNPPG DVVAVAPGAI CDTGWDDGYG WYIEINHGIS       420
     DEVKALYPDA ERWCSYYAHL DEKPTQAIGT KVEADALIGH IGNTGRSTGP HLHFEVRIYH       480
     KNGSYRSGDA RYDKINPYPA ERQEE                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page