(data stored in ACNUC7421 zone)

EMBL: CP002116.PE238

CP002116.PE238       Location/Qualifiers
FT   CDS             247587..248948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0241"
FT                   /product="DNA photolyase FAD-binding protein"
FT                   /note="COGs: COG0415 Deoxyribodipyrimidine photolyase;
FT                   InterPro IPR006050:IPR005101:IPR008148; KEGG: hmo:HM1_1861
FT                   deoxyribodipyrimidine photolyase; PFAM: DNA photolyase
FT                   FAD-binding; DNA photolyase domain protein; SPTR:
FT                   Deoxyribodipyrimidine photolyase; manually curated; PFAM:
FT                   FAD binding domain of DNA photolyase; DNA photolyase;
FT                   TIGRFAM: photolyase PhrII"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79398"
FT                   /db_xref="GOA:E1RAA7"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR032673"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAA7"
FT                   /protein_id="ADK79398.1"
FT                   /translation="MIQNERLFLLKKGECNEKGAYVLYWMQQSQRSRYNHALEYALGEA
FT                   NRRSLPLLVLFVVSRDYLGAGRRHYRFLLEGIEQLEVDLADRGIGFLLKIGDPPGIVAE
FT                   FAADAALVVFDTGYTRLQRSWRKAAAAGSFCAPVMEVESDLVVPVRTASGKEEYSAATI
FT                   RRKITPLLFRFMQPLKRQSAKIDSTALAGRADGLDSKAAEELLRFSQPEVEPVSWIHGG
FT                   SVEAHRRLDAFITSGTLERFHEERNDPSKEGLSCMSPYLHYGQISALEIALRASEHPGP
FT                   GCEAFLEELIIRRELAFNFVFYNRFYDSFEALPRWAREDLEAHEGDKREVLYDDAQLEE
FT                   AKTHDPYWNAAQRELTHKGKMHGYMRMYWGKKILEWSASPREAFERALRLNDRYSLDGR
FT                   DPNGYTGVAWCFGKHDRPWASRPVFGKIRYMNDRGLERKFDIASYVKQVQKSCE"
     MIQNERLFLL KKGECNEKGA YVLYWMQQSQ RSRYNHALEY ALGEANRRSL PLLVLFVVSR        60
     DYLGAGRRHY RFLLEGIEQL EVDLADRGIG FLLKIGDPPG IVAEFAADAA LVVFDTGYTR       120
     LQRSWRKAAA AGSFCAPVME VESDLVVPVR TASGKEEYSA ATIRRKITPL LFRFMQPLKR       180
     QSAKIDSTAL AGRADGLDSK AAEELLRFSQ PEVEPVSWIH GGSVEAHRRL DAFITSGTLE       240
     RFHEERNDPS KEGLSCMSPY LHYGQISALE IALRASEHPG PGCEAFLEEL IIRRELAFNF       300
     VFYNRFYDSF EALPRWARED LEAHEGDKRE VLYDDAQLEE AKTHDPYWNA AQRELTHKGK       360
     MHGYMRMYWG KKILEWSASP REAFERALRL NDRYSLDGRD PNGYTGVAWC FGKHDRPWAS       420
     RPVFGKIRYM NDRGLERKFD IASYVKQVQK SCE                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page