(data stored in ACNUC7421 zone)

EMBL: CP002116.PE24

CP002116.PE24        Location/Qualifiers
FT   CDS             20456..21319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0024"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="COGs: COG1737 Transcriptional regulators; InterPro
FT                   IPR000281:IPR001347; KEGG: cdl:CDR20291_1955 RpiR-family
FT                   transcriptional regulator; PFAM: helix-turn-helix protein
FT                   RpiR; sugar isomerase (SIS); SPTR: Putative uncharacterized
FT                   protein; PFAM: Helix-turn-helix domain, rpiR family; SIS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79184"
FT                   /db_xref="GOA:E1R6Q2"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q2"
FT                   /protein_id="ADK79184.1"
FT                   /translation="MDILEQIKSEYPNYNSTRKRIASFILENPTRCCFLSLKEFAEEAR
FT                   STEVTVLNFCRSLGLGRYVELKKALQSHVLIWTRPADRMKALASRSSDSNELFDQVVKS
FT                   EQKALRSTFEHNGPKQILSFIQMIRKARRVFVAAHGASRIFSSVITYRLSLLGVDISEL
FT                   DMDNPHKTIFRLLSCNPEESLLIAIATPPYGKNTIATTRMCRSRGISVVTITDSTLSPL
FT                   VSMAETALICPTELMGLTNSPTSIMAIIDIIAVLFLAEKQEDEFSHQEDLAQQYEHYLK
FT                   LFNSEL"
     MDILEQIKSE YPNYNSTRKR IASFILENPT RCCFLSLKEF AEEARSTEVT VLNFCRSLGL        60
     GRYVELKKAL QSHVLIWTRP ADRMKALASR SSDSNELFDQ VVKSEQKALR STFEHNGPKQ       120
     ILSFIQMIRK ARRVFVAAHG ASRIFSSVIT YRLSLLGVDI SELDMDNPHK TIFRLLSCNP       180
     EESLLIAIAT PPYGKNTIAT TRMCRSRGIS VVTITDSTLS PLVSMAETAL ICPTELMGLT       240
     NSPTSIMAII DIIAVLFLAE KQEDEFSHQE DLAQQYEHYL KLFNSEL                     287
//

If you have problems or comments...

PBIL Back to PBIL home page