(data stored in ACNUC7421 zone)

EMBL: CP002116.PE241

CP002116.PE241       Location/Qualifiers
FT   CDS             complement(250896..251363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0244"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR008254; KEGG: mac:MA2078 flavodoxin;
FT                   SPTR: Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79401"
FT                   /db_xref="GOA:E1RAB0"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB0"
FT                   /protein_id="ADK79401.1"
FT                   /translation="MVKKILIAYSSYFGNCKKAASTLAASCDEEGMETSLYPILESETL
FT                   PEKPDILVLVTPVRVRKIVGPSKKFLRKIGEKDLRYALVVSHGAALDHFFSPVPATKKL
FT                   ERHLERKEMVRITEPLFLQVERQQGPLSKGYEKRLADLAKQLSQAVSEEDR"
     MVKKILIAYS SYFGNCKKAA STLAASCDEE GMETSLYPIL ESETLPEKPD ILVLVTPVRV        60
     RKIVGPSKKF LRKIGEKDLR YALVVSHGAA LDHFFSPVPA TKKLERHLER KEMVRITEPL       120
     FLQVERQQGP LSKGYEKRLA DLAKQLSQAV SEEDR                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page