(data stored in ACNUC7421 zone)

EMBL: CP002116.PE242

CP002116.PE242       Location/Qualifiers
FT   CDS             complement(251906..252343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fnu:FN1201 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79402"
FT                   /db_xref="GOA:E1RAB1"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB1"
FT                   /protein_id="ADK79402.1"
FT                   /translation="MKKVDDSNIMEGLEEKREEIIREINEYNRERDQIRAMLGKIGGKS
FT                   YSKTDMIINIVFLTIILLLFILELTTHFLPAFISLEVSVLLVSIKIVWMIHSQHRFNHF
FT                   QFWVLNSIEFRINNMHKMVRGMEKELKQLREDKHNTNAVGP"
     MKKVDDSNIM EGLEEKREEI IREINEYNRE RDQIRAMLGK IGGKSYSKTD MIINIVFLTI        60
     ILLLFILELT THFLPAFISL EVSVLLVSIK IVWMIHSQHR FNHFQFWVLN SIEFRINNMH       120
     KMVRGMEKEL KQLREDKHNT NAVGP                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page