(data stored in ACNUC7421 zone)

EMBL: CP002116.PE243

CP002116.PE243       Location/Qualifiers
FT   CDS             complement(252373..253653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0247"
FT                   /product="protein of unknown function DUF401"
FT                   /note="COGs: COG1906 conserved hypothetical protein;
FT                   InterPro IPR007294; KEGG: dol:Dole_1082 hypothetical
FT                   protein; PFAM: protein of unknown function DUF401; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF401); TIGRFAM: converved hypothetical integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79403"
FT                   /db_xref="GOA:E1RAB2"
FT                   /db_xref="InterPro:IPR007294"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB2"
FT                   /protein_id="ADK79403.1"
FT                   /translation="MTIPLMLKIILSLALILVLNKIVRNLAISVAAGALLIAFWSGQTI
FT                   VTAGVIASKRMLSFDNFALLLLIALVITLSNQMNQTGMMKQLVGGLKARVSQKEALAAL
FT                   PAVIGLLPMPGGALFSAPLLDDCDDRGELSPMQKTKINYWFRHVWEFTWPLYPGVILAS
FT                   DIAHVEVWQIFFLGLPLSLVSITVGYLFYLRPLKLTAERRESNSKSNGPSLVSLLAPIM
FT                   IVVVIYFLIMVFLPAVGTLSKYLPMIIGLLSSILYLQIISPLTRKEWKKIALSHRTLQM
FT                   VLIVLVVRVYGAFIEAPLPNGILLMEQLRLELTAAGVPLRLLVLLIPFISGMTTGVSVG
FT                   FVGACFPIVFSLLGPSPTLASTLSTLALAYPFGFMGTMMSPVHVCLIVTNEHYGTNLGP
FT                   SIGAVIPPAIFVMAGSLLISYIVPFIV"
     MTIPLMLKII LSLALILVLN KIVRNLAISV AAGALLIAFW SGQTIVTAGV IASKRMLSFD        60
     NFALLLLIAL VITLSNQMNQ TGMMKQLVGG LKARVSQKEA LAALPAVIGL LPMPGGALFS       120
     APLLDDCDDR GELSPMQKTK INYWFRHVWE FTWPLYPGVI LASDIAHVEV WQIFFLGLPL       180
     SLVSITVGYL FYLRPLKLTA ERRESNSKSN GPSLVSLLAP IMIVVVIYFL IMVFLPAVGT       240
     LSKYLPMIIG LLSSILYLQI ISPLTRKEWK KIALSHRTLQ MVLIVLVVRV YGAFIEAPLP       300
     NGILLMEQLR LELTAAGVPL RLLVLLIPFI SGMTTGVSVG FVGACFPIVF SLLGPSPTLA       360
     STLSTLALAY PFGFMGTMMS PVHVCLIVTN EHYGTNLGPS IGAVIPPAIF VMAGSLLISY       420
     IVPFIV                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page