(data stored in ACNUC7421 zone)

EMBL: CP002116.PE244

CP002116.PE244       Location/Qualifiers
FT   CDS             253778..254299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0248"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="COGs: COG0735 Fe2+/Zn2+ uptake regulation protein;
FT                   InterPro IPR002481; KEGG: tye:THEYE_A1865 ferric uptake
FT                   regulation protein; PFAM: ferric-uptake regulator; SPTR:
FT                   Ferric uptake regulation protein; PFAM: Ferric uptake
FT                   regulator family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79404"
FT                   /db_xref="GOA:E1RAB3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB3"
FT                   /protein_id="ADK79404.1"
FT                   /translation="MDYSSRGYGRGFGRGCSRAEGPFQRKGVRMTLTRRVIIEALDRAD
FT                   GYLSAEELFLIVREEYPGIGVATIYRTLQLLEELALVQRVETGEGRARYAMSRDKDAGE
FT                   AGVGNEVVLICDRCGKVIRQPKAAARCSELFDSLSRKAEENYRFHTERQVLQIHGLCAG
FT                   CTGAPSEKSR"
     MDYSSRGYGR GFGRGCSRAE GPFQRKGVRM TLTRRVIIEA LDRADGYLSA EELFLIVREE        60
     YPGIGVATIY RTLQLLEELA LVQRVETGEG RARYAMSRDK DAGEAGVGNE VVLICDRCGK       120
     VIRQPKAAAR CSELFDSLSR KAEENYRFHT ERQVLQIHGL CAGCTGAPSE KSR              173
//

If you have problems or comments...

PBIL Back to PBIL home page