(data stored in ACNUC7421 zone)

EMBL: CP002116.PE246

CP002116.PE246       Location/Qualifiers
FT   CDS             254675..255043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0250"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="COGs: COG1433 conserved hypothetical protein;
FT                   InterPro IPR003731; KEGG: mla:Mlab_1056 hypothetical
FT                   protein; PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; SPTR: Dinitrogenase iron-molybdenum
FT                   cofactor biosynthesis protein; PFAM: Dinitrogenase
FT                   iron-molybdenum cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79406"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB5"
FT                   /protein_id="ADK79406.1"
FT                   /translation="MKVAVAADGTMVSGHFGHCEQFVVADIANGRVESTTPVANPGHTP
FT                   GALPPFVASLGASKIVAGGMGPRAIELFEANGVGCILGISGPISDALEKLAKGELEGGE
FT                   SSCTGSHDHDCDHEEGRI"
     MKVAVAADGT MVSGHFGHCE QFVVADIANG RVESTTPVAN PGHTPGALPP FVASLGASKI        60
     VAGGMGPRAI ELFEANGVGC ILGISGPISD ALEKLAKGEL EGGESSCTGS HDHDCDHEEG       120
     RI                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page