(data stored in ACNUC7421 zone)

EMBL: CP002116.PE247

CP002116.PE247       Location/Qualifiers
FT   CDS             255047..255403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0251"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="COGs: COG1433 conserved hypothetical protein;
FT                   InterPro IPR003731; KEGG: mma:MM_0988 hypothetical protein;
FT                   PFAM: Dinitrogenase iron-molybdenum cofactor biosynthesis
FT                   protein; SPTR: Conserved protein; PFAM: Dinitrogenase
FT                   iron-molybdenum cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79407"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB6"
FT                   /protein_id="ADK79407.1"
FT                   /translation="MIICITASGREESSQQDPRFGRCEAFYLFDDTKKEGRFIDNPFKN
FT                   AVGGAGVRAAELIVKEGASRLVSGQIGPNAWDVLKEAGIRVFSSKEANIRAALEAFLAG
FT                   NLSEVEAPGPAGHK"
     MIICITASGR EESSQQDPRF GRCEAFYLFD DTKKEGRFID NPFKNAVGGA GVRAAELIVK        60
     EGASRLVSGQ IGPNAWDVLK EAGIRVFSSK EANIRAALEA FLAGNLSEVE APGPAGHK         118
//

If you have problems or comments...

PBIL Back to PBIL home page