(data stored in ACNUC7421 zone)

EMBL: CP002116.PE248

CP002116.PE248       Location/Qualifiers
FT   CDS             255400..256272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0252"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="COGs: COG1149 MinD superfamily P-loop ATPase
FT                   containing an inserted ferredoxin domain; InterPro
FT                   IPR002586:IPR001450:IPR017896:IPR017900; KEGG: pth:PTH_0584
FT                   MinD family ATPase; PFAM: Cobyrinic acid ac-diamide
FT                   synthase; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; SPTR: Cobyrinic acid a,c-diamide synthase; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain; 4Fe-4S
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79408"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB7"
FT                   /protein_id="ADK79408.1"
FT                   /translation="MTITVASGKGGTGKTTIATALAMLWPEPVALLDADVEEPNCRFFL
FT                   DTTEGKQREVFLPVPQIDEAICTGCGACSSFCRYGALVRIGKKVMTFPNLCHSCGACMM
FT                   VCPEGAISEKPSFIGTIDSAQFRALDGSLRTHRWGTLKLGAAMAPPLIRELRREKDKEP
FT                   LQLIDSPPGASCPMANAVKNADLVLMVAENTPFGAHDLEKAISTLEEMDLPVLALINRA
FT                   DLGGGEAEAVCRRKGIDIIGRVPFDRKVAESYARGVHPILEVPAFRQAVEQVVGHLIAF
FT                   LQTSIEQKT"
     MTITVASGKG GTGKTTIATA LAMLWPEPVA LLDADVEEPN CRFFLDTTEG KQREVFLPVP        60
     QIDEAICTGC GACSSFCRYG ALVRIGKKVM TFPNLCHSCG ACMMVCPEGA ISEKPSFIGT       120
     IDSAQFRALD GSLRTHRWGT LKLGAAMAPP LIRELRREKD KEPLQLIDSP PGASCPMANA       180
     VKNADLVLMV AENTPFGAHD LEKAISTLEE MDLPVLALIN RADLGGGEAE AVCRRKGIDI       240
     IGRVPFDRKV AESYARGVHP ILEVPAFRQA VEQVVGHLIA FLQTSIEQKT                  290
//

If you have problems or comments...

PBIL Back to PBIL home page