(data stored in ACNUC7421 zone)

EMBL: CP002116.PE25

CP002116.PE25        Location/Qualifiers
FT   CDS             21403..22392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0025"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: fnu:FN0397 peptide ABC transporter permease; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Putative uncharacterized protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79185"
FT                   /db_xref="GOA:E1R6Q3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q3"
FT                   /protein_id="ADK79185.1"
FT                   /translation="MWKYILKRLLMMIPVLIGVTFIVFFIMALTPGDPAAIILGDQASA
FT                   EALALKRIELGLDKPIPIRYLNYVNDMFHGDLGTSYKNQIKVWDQVWDKFPNTAILAVA
FT                   GILVALLIGIPIGILSAKKQYTFMDNSSMVLSLIGVSMPNFWLGLLLSLFFALKLGWLP
FT                   SQGMGTGFFPLLRSLVLPAITLGTGAAATVVRMTRSSMLEVIRQDYISTARAKGLSEKA
FT                   VTRHHMLKNAMIPIVTAVGLQFGQLLGGAMLTETIFSWPGLGRLMVDSITSKDIPMVLG
FT                   AVIFMAVMFSFVNLLVDIIYAFIDPRIKSQYDKAGVKRIGFRKRSIAA"
     MWKYILKRLL MMIPVLIGVT FIVFFIMALT PGDPAAIILG DQASAEALAL KRIELGLDKP        60
     IPIRYLNYVN DMFHGDLGTS YKNQIKVWDQ VWDKFPNTAI LAVAGILVAL LIGIPIGILS       120
     AKKQYTFMDN SSMVLSLIGV SMPNFWLGLL LSLFFALKLG WLPSQGMGTG FFPLLRSLVL       180
     PAITLGTGAA ATVVRMTRSS MLEVIRQDYI STARAKGLSE KAVTRHHMLK NAMIPIVTAV       240
     GLQFGQLLGG AMLTETIFSW PGLGRLMVDS ITSKDIPMVL GAVIFMAVMF SFVNLLVDII       300
     YAFIDPRIKS QYDKAGVKRI GFRKRSIAA                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page