(data stored in ACNUC7421 zone)

EMBL: CP002116.PE250

CP002116.PE250       Location/Qualifiers
FT   CDS             257236..258060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0254"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="COGs: COG0489 ATPase involved in chromosome
FT                   partitioning; InterPro IPR019591; KEGG: ddf:DEFDS_1268
FT                   ATP-binding protein, CobQ/CobB/MinD/ParA family; PFAM:
FT                   ATPase-like, ParA/MinD; SPTR: Nucleotide-binding protein;
FT                   PFAM: ParA/MinD ATPase like; Anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79410"
FT                   /db_xref="GOA:E1RAB9"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAB9"
FT                   /protein_id="ADK79410.1"
FT                   /translation="MAFPPSEEQKAQNERLKKRMSGIKHKVLVMSGKGGVGKSSVSANL
FT                   ALEMASRGVKVGILDTDLHGPNIPKMLGVDDAKLIAYDEGIEPFAVTKNLVAVSLAMAG
FT                   HDVDAPIIWRGPVKIGVIRQFLADVEWGDLDLLVIDTPPGTGDEPLTVAQMIPELDGAI
FT                   VVTTPQEVAILDSRKSVNFAKQLNLPLIGIVENMSGFICPNCGTEHQLFGSGGGERAAK
FT                   EMGVPFLGKIPIDPLLMNAEDSGRSYLSLPDTGPAAAALRSLVDKTAAFIGL"
     MAFPPSEEQK AQNERLKKRM SGIKHKVLVM SGKGGVGKSS VSANLALEMA SRGVKVGILD        60
     TDLHGPNIPK MLGVDDAKLI AYDEGIEPFA VTKNLVAVSL AMAGHDVDAP IIWRGPVKIG       120
     VIRQFLADVE WGDLDLLVID TPPGTGDEPL TVAQMIPELD GAIVVTTPQE VAILDSRKSV       180
     NFAKQLNLPL IGIVENMSGF ICPNCGTEHQ LFGSGGGERA AKEMGVPFLG KIPIDPLLMN       240
     AEDSGRSYLS LPDTGPAAAA LRSLVDKTAA FIGL                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page