(data stored in ACNUC7421 zone)

EMBL: CP002116.PE251

CP002116.PE251       Location/Qualifiers
FT   CDS             258190..260424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0255"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR003660:IPR004089; KEGG: dba:Dbac_1917
FT                   methyl-accepting chemotaxis sensory transducer; PFAM:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein; SMART: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SPTR:
FT                   Methyl-accepting chemotaxis sensory transducer; PFAM: HAMP
FT                   domain; Methyl-accepting chemotaxis protein (MCP) signaling
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79411"
FT                   /db_xref="GOA:E1RAC0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC0"
FT                   /protein_id="ADK79411.1"
FT                   /translation="MLKNIRMGVKLVGAFFIVALLVLVVGFVGMIGLRRLNVFISDIGQ
FT                   GRLPAVESLLRMENEVQNIRGSVRTLLSSRLTLDDRQRQYDNIDSARADYGEYRTVYEK
FT                   FPKASEESRKWTEATRLLGELTDLNNSIVDLSKKVEESGIIHPDSFKSTIIELVNDHHV
FT                   LMEQAIAAIGSGTVFTGGDDAESCDLGQFLLTFKTDNPVLLRVLKEVPKYHDAFHEGIS
FT                   EVQDALSRGDRDTAFALYQDKVVRNATRVFELLNQMLGEADRVVQLYDEMNLIAMGDAA
FT                   TVQRSFVDALGWVVSYNSDLAANTVDQAIVNSGQAIRFTIVGMVVASLLALILGLGLTQ
FT                   AITAPMRLGVNFAKAISLGDLGIELSIRQKDEVGQLAEAMREMQIALQDKARVLERIAD
FT                   GDLSVDAKKASEKDGLGESMLRMKKNLNDLLGQVHMAVEQVTAGADQVSQASQSLSQGA
FT                   TEQASSLEEVSSSATEINSQARQNAENATEANALAKKAAADAKNGNSQMMDLKEAMAKI
FT                   NVSSDQIKKVVKVIDDIAFQINLLALNANVEAARAGKYGKGFAVVAEEVRNLAVRSASA
FT                   VQETTSMVEESIRNIELGNAAVGTTAGQLESIVDGAGKVADFLEEIATASREQAQAIDQ
FT                   ISEGLDQIDQVTQSNTASAEESASASEELAGQAQQLQGLIRQFILDERYVSGLRSSGSR
FT                   SLPAPGGRRVPRPSKERTVKEHPREEFETGIAPVSPEDVIKLDDDDFDRF"
     MLKNIRMGVK LVGAFFIVAL LVLVVGFVGM IGLRRLNVFI SDIGQGRLPA VESLLRMENE        60
     VQNIRGSVRT LLSSRLTLDD RQRQYDNIDS ARADYGEYRT VYEKFPKASE ESRKWTEATR       120
     LLGELTDLNN SIVDLSKKVE ESGIIHPDSF KSTIIELVND HHVLMEQAIA AIGSGTVFTG       180
     GDDAESCDLG QFLLTFKTDN PVLLRVLKEV PKYHDAFHEG ISEVQDALSR GDRDTAFALY       240
     QDKVVRNATR VFELLNQMLG EADRVVQLYD EMNLIAMGDA ATVQRSFVDA LGWVVSYNSD       300
     LAANTVDQAI VNSGQAIRFT IVGMVVASLL ALILGLGLTQ AITAPMRLGV NFAKAISLGD       360
     LGIELSIRQK DEVGQLAEAM REMQIALQDK ARVLERIADG DLSVDAKKAS EKDGLGESML       420
     RMKKNLNDLL GQVHMAVEQV TAGADQVSQA SQSLSQGATE QASSLEEVSS SATEINSQAR       480
     QNAENATEAN ALAKKAAADA KNGNSQMMDL KEAMAKINVS SDQIKKVVKV IDDIAFQINL       540
     LALNANVEAA RAGKYGKGFA VVAEEVRNLA VRSASAVQET TSMVEESIRN IELGNAAVGT       600
     TAGQLESIVD GAGKVADFLE EIATASREQA QAIDQISEGL DQIDQVTQSN TASAEESASA       660
     SEELAGQAQQ LQGLIRQFIL DERYVSGLRS SGSRSLPAPG GRRVPRPSKE RTVKEHPREE       720
     FETGIAPVSP EDVIKLDDDD FDRF                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page