(data stored in ACNUC7421 zone)

EMBL: CP002116.PE252

CP002116.PE252       Location/Qualifiers
FT   CDS             260436..260930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0256"
FT                   /product="CheW protein"
FT                   /note="COGs: COG0835 Chemotaxis signal transduction
FT                   protein; InterPro IPR002545; KEGG: cce:Ccel_2314 CheW
FT                   protein; PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; SPTR: CheW protein; PFAM: CheW-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79412"
FT                   /db_xref="GOA:E1RAC1"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC1"
FT                   /protein_id="ADK79412.1"
FT                   /translation="MSDQVSGSGDVMIDEEDDIVANKYLLSKIGNELYGIDIRFVTDII
FT                   EMQKITEVPDMEEYVRGVINLRGQVIPVIDLRLRFGMAFREYDDRTCIIIVNVGESSIG
FT                   FIVDTVSEVIDIPDGSIDPPPEYKSEGGSSRRFVSGLGKVGDSVKLLLDVEAIVSHTTS
FT                   T"
     MSDQVSGSGD VMIDEEDDIV ANKYLLSKIG NELYGIDIRF VTDIIEMQKI TEVPDMEEYV        60
     RGVINLRGQV IPVIDLRLRF GMAFREYDDR TCIIIVNVGE SSIGFIVDTV SEVIDIPDGS       120
     IDPPPEYKSE GGSSRRFVSG LGKVGDSVKL LLDVEAIVSH TTST                        164
//

If you have problems or comments...

PBIL Back to PBIL home page