(data stored in ACNUC7421 zone)

EMBL: CP002116.PE253

CP002116.PE253       Location/Qualifiers
FT   CDS             261105..261710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0257"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="COGs: COG0170 Dolichol kinase; InterPro IPR000374;
FT                   KEGG: tde:TDE2717 phosphatidate cytidylyltransferase,
FT                   putative; PFAM: phosphatidate cytidylyltransferase; SPTR:
FT                   Phosphatidate cytidylyltransferase; PFAM:
FT                   Cytidylyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79413"
FT                   /db_xref="GOA:E1RAC2"
FT                   /db_xref="InterPro:IPR032974"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC2"
FT                   /protein_id="ADK79413.1"
FT                   /translation="MRTTFQGDTEKIRTEIIRKSIHMMVAFVPAFARINIGLTMALLAA
FT                   SVVAYSVAELLRVNGKKIFLISTITEAANRNRNNSAFVFGPVTLALGAMMTLLLYPSQV
FT                   AAIAVYALAFGDGFSSLFGRLYGRVRVPFTEGKTFAGSFACLLAVFFSSLSVSGNIEQS
FT                   VLIAIAATLLEISISGDLDNLVLPIGTGFVAWLVGVGI"
     MRTTFQGDTE KIRTEIIRKS IHMMVAFVPA FARINIGLTM ALLAASVVAY SVAELLRVNG        60
     KKIFLISTIT EAANRNRNNS AFVFGPVTLA LGAMMTLLLY PSQVAAIAVY ALAFGDGFSS       120
     LFGRLYGRVR VPFTEGKTFA GSFACLLAVF FSSLSVSGNI EQSVLIAIAA TLLEISISGD       180
     LDNLVLPIGT GFVAWLVGVG I                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page