(data stored in ACNUC7421 zone)

EMBL: CP002116.PE254

CP002116.PE254       Location/Qualifiers
FT   CDS             complement(261720..262487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tde:TDE1445 hypothetical protein; SPTR:
FT                   Putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79414"
FT                   /db_xref="GOA:E1RAC3"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC3"
FT                   /protein_id="ADK79414.1"
FT                   /translation="MISRRNSLQIFGLLISILLTGVGVYGILLQFRTGTTVGDELIRQI
FT                   LLLGEGAFAIIGSLFLMLFFRNTPSPGVLFFILAVQATAFGALRPLSAALFSLNYSYQI
FT                   PAAITRAYYFGRFLSILALFISGLFAAGLALQRRTIMFGSAFFMALTLAAVLPVDISEY
FT                   TPQLLFSIGARSSMFLGYGVIAVLSTANYLIAALHQGNRNYYLVACGVFFMIIGKEFVY
FT                   RSIAPEAAAIGLLCMIVGAYLFGSRTHTIYLWL"
     MISRRNSLQI FGLLISILLT GVGVYGILLQ FRTGTTVGDE LIRQILLLGE GAFAIIGSLF        60
     LMLFFRNTPS PGVLFFILAV QATAFGALRP LSAALFSLNY SYQIPAAITR AYYFGRFLSI       120
     LALFISGLFA AGLALQRRTI MFGSAFFMAL TLAAVLPVDI SEYTPQLLFS IGARSSMFLG       180
     YGVIAVLSTA NYLIAALHQG NRNYYLVACG VFFMIIGKEF VYRSIAPEAA AIGLLCMIVG       240
     AYLFGSRTHT IYLWL                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page