(data stored in ACNUC7421 zone)

EMBL: CP002116.PE255

CP002116.PE255       Location/Qualifiers
FT   CDS             complement(262520..264109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0259"
FT                   /product="Glycoside hydrolase family 79"
FT                   /note="InterPro IPR005199; KEGG: mmw:Mmwyl1_1639
FT                   hypothetical protein; PFAM: Glycoside hydrolase family 79;
FT                   SPTR: Putative uncharacterized protein; PFAM: Glycosyl
FT                   hydrolase family 79, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79415"
FT                   /db_xref="GOA:E1RAC4"
FT                   /db_xref="InterPro:IPR005199"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC4"
FT                   /protein_id="ADK79415.1"
FT                   /translation="MNGNYYPVSMSSPRHYTICIGSRKPIRSLPADFLSLTIDSSLLLG
FT                   GHWWGKSRSFAKGVSGEQVAPLDLEHSQLVAYAAQLAPAMLRIGGTEADWVRYKMGKKA
FT                   LRKLRGAKPASHRIGNSNDRPAYELVLKKGVWKRLNRFIKESGFDLLFTLSAGPADRDS
FT                   NGAWRSDNAMRLVAYSVQKGFRVAAWEFGNEVNGFPFLYGPKKRVSASQYSRDFEYFSE
FT                   SVKHIDPQAKIIGPASAIWPIIGEPNPIIKKLCVSPAARHLDAVSWHYYPQQSHHGPIA
FT                   VRRAGTYRMLSPGNLNDIVRWNRNIQRYLKKSREHPTSTENWLTETAHALYGGEPGLSD
FT                   SFVSTLWWLDELGVLARNGVDKVFRQSLIGARYGLLDQESMKPKPDYYASFLWKKLMGN
FT                   LVLETGTTIGTNKKLRYYRHTTGAYFAGSAAEALLLINLNRKTSAHVEITTPDAPFSIG
FT                   HTILLQADGGFTSKSMLVNGVPAEDDLVFSWGTKKVMKKYKISGKKNERITKELSLPPL
FT                   SALFYLFARPEN"
     MNGNYYPVSM SSPRHYTICI GSRKPIRSLP ADFLSLTIDS SLLLGGHWWG KSRSFAKGVS        60
     GEQVAPLDLE HSQLVAYAAQ LAPAMLRIGG TEADWVRYKM GKKALRKLRG AKPASHRIGN       120
     SNDRPAYELV LKKGVWKRLN RFIKESGFDL LFTLSAGPAD RDSNGAWRSD NAMRLVAYSV       180
     QKGFRVAAWE FGNEVNGFPF LYGPKKRVSA SQYSRDFEYF SESVKHIDPQ AKIIGPASAI       240
     WPIIGEPNPI IKKLCVSPAA RHLDAVSWHY YPQQSHHGPI AVRRAGTYRM LSPGNLNDIV       300
     RWNRNIQRYL KKSREHPTST ENWLTETAHA LYGGEPGLSD SFVSTLWWLD ELGVLARNGV       360
     DKVFRQSLIG ARYGLLDQES MKPKPDYYAS FLWKKLMGNL VLETGTTIGT NKKLRYYRHT       420
     TGAYFAGSAA EALLLINLNR KTSAHVEITT PDAPFSIGHT ILLQADGGFT SKSMLVNGVP       480
     AEDDLVFSWG TKKVMKKYKI SGKKNERITK ELSLPPLSAL FYLFARPEN                   529
//

If you have problems or comments...

PBIL Back to PBIL home page