(data stored in ACNUC7421 zone)

EMBL: CP002116.PE256

CP002116.PE256       Location/Qualifiers
FT   CDS             264202..264897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0260"
FT                   /product="Protein of unknown function DUF2259, secreted"
FT                   /note="COGs: COG5497 secreted protein; InterPro IPR018725;
FT                   KEGG: tde:TDE1519 hypothetical protein; PFAM: Protein of
FT                   unknown function DUF2259, secreted; SPTR: Putative
FT                   uncharacterized protein; PFAM: Predicted secreted protein
FT                   (DUF2259)"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79416"
FT                   /db_xref="InterPro:IPR018725"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC5"
FT                   /protein_id="ADK79416.1"
FT                   /translation="MHKRALLAAFLLTLACSGAFAGDVAVFENLGFSDDSRYLLFGQYG
FT                   ILSDETRAYAELYAVDVAKNSYLSGGVLKKVYSDEIFPGQDGSGALYMALREFSPIVSK
FT                   YKFNHLATGRMVYLLLNGAEPQDRLEFRDFQRGDSFSVDLIQHRYGEGEGTNLSSSFHI
FT                   SVMITDAAGKSRTYQVGHPDFKRKGVLEYRIKEVFFSPDEKGLVFVVERDEVDGNGNNI
FT                   RYMVETLRW"
     MHKRALLAAF LLTLACSGAF AGDVAVFENL GFSDDSRYLL FGQYGILSDE TRAYAELYAV        60
     DVAKNSYLSG GVLKKVYSDE IFPGQDGSGA LYMALREFSP IVSKYKFNHL ATGRMVYLLL       120
     NGAEPQDRLE FRDFQRGDSF SVDLIQHRYG EGEGTNLSSS FHISVMITDA AGKSRTYQVG       180
     HPDFKRKGVL EYRIKEVFFS PDEKGLVFVV ERDEVDGNGN NIRYMVETLR W                231
//

If you have problems or comments...

PBIL Back to PBIL home page