(data stored in ACNUC7421 zone)

EMBL: CP002116.PE257

CP002116.PE257       Location/Qualifiers
FT   CDS             265017..266447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0261"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="COGs: COG0442 Prolyl-tRNA synthetase;
FT                   InterProIPR002316:IPR004499:IPR002314:IPR004154:IPR
FT                   016061:IPR006195; KEGG: paa:Paes_1587 prolyl-tRNA
FT                   synthetase; PFAM: Anticodon-binding domain protein; tRNA
FT                   synthetase class II (G H P and S); Prolyl-tRNA synthetase,
FT                   class II-like; PRIAM: Proline--tRNA ligase; SPTR:
FT                   Prolyl-tRNA synthetase; TIGRFAM: prolyl-tRNA synthetase;
FT                   PFAM: Anticodon binding domain; Prolyl-tRNA synthetase,
FT                   C-terminal; tRNA synthetase class II core domain (G, H, P,
FT                   S and T); TIGRFAM: prolyl-tRNA synthetase, family I"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79417"
FT                   /db_xref="GOA:E1RAC6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC6"
FT                   /protein_id="ADK79417.1"
FT                   /translation="MAEKITPRSENYSQWYVDIILNAKLADYSPVKGSMVIRPHGYALW
FT                   EAIQRNLDDMFKATGHTNAYFPLLIPESFIKKEAEHVEGFSPELAVVTHAGGEELEEPL
FT                   VIRPTSETIIWSMYKKWIQSYRDLPLLINQWANVLRWEKRTRLFLRTSEFLWQEGHTAH
FT                   ATEKEAREETLRMLNVYKEFAEKWMAIPVLTGVKSPSEKFAGAIDTYAIEAMMQDHKAL
FT                   QAGTSHFLGQNFAKAFDVTFQNDTGSLEYVWATSWGVSTRLVGALIMTHSDDKGLVVPP
FT                   KLSPVEAVIIPIFRNKNKEEVVGYARKLYDRMKDEFRVKLDADDSNSPGWKFAEWEMLG
FT                   CPVRIELGPRDMENGKAVLVRRDNGEKEIVDIEAVPARVGELLESIQTTLFQRALENRE
FT                   THTYDVDSYDRFKAIFDGEGGFIRMPWCGDAECEAAIKEETKATIRLIPFEQPELKGAV
FT                   CPRCGKPADKIAVYARSY"
     MAEKITPRSE NYSQWYVDII LNAKLADYSP VKGSMVIRPH GYALWEAIQR NLDDMFKATG        60
     HTNAYFPLLI PESFIKKEAE HVEGFSPELA VVTHAGGEEL EEPLVIRPTS ETIIWSMYKK       120
     WIQSYRDLPL LINQWANVLR WEKRTRLFLR TSEFLWQEGH TAHATEKEAR EETLRMLNVY       180
     KEFAEKWMAI PVLTGVKSPS EKFAGAIDTY AIEAMMQDHK ALQAGTSHFL GQNFAKAFDV       240
     TFQNDTGSLE YVWATSWGVS TRLVGALIMT HSDDKGLVVP PKLSPVEAVI IPIFRNKNKE       300
     EVVGYARKLY DRMKDEFRVK LDADDSNSPG WKFAEWEMLG CPVRIELGPR DMENGKAVLV       360
     RRDNGEKEIV DIEAVPARVG ELLESIQTTL FQRALENRET HTYDVDSYDR FKAIFDGEGG       420
     FIRMPWCGDA ECEAAIKEET KATIRLIPFE QPELKGAVCP RCGKPADKIA VYARSY           476
//

If you have problems or comments...

PBIL Back to PBIL home page