(data stored in ACNUC7421 zone)

EMBL: CP002116.PE258

CP002116.PE258       Location/Qualifiers
FT   CDS             266484..267131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saz:Sama_1067 putative sulfate transporter
FT                   YchM; SPTR: Sulfate permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79418"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC7"
FT                   /protein_id="ADK79418.1"
FT                   /translation="MRSTFHFLALFSILCTVAVSSISASPHMEGVELFGGGIWTGNSRS
FT                   DAGAPSPIYPSLTIGLPLRLGNGPFSFVPALTLYKAWYLYDESEEAAIPAELEQRDITA
FT                   VEIIIDSSFRFDMIKRKSFVTGPELSLSFDLPVPIVVWENEDESSSLVSDLYDSGKFFL
FT                   PGVGWHWTVILHDTHPLLFNLKSYLPLHRFWDGEDLPFYDRLKIALRVGYRF"
     MRSTFHFLAL FSILCTVAVS SISASPHMEG VELFGGGIWT GNSRSDAGAP SPIYPSLTIG        60
     LPLRLGNGPF SFVPALTLYK AWYLYDESEE AAIPAELEQR DITAVEIIID SSFRFDMIKR       120
     KSFVTGPELS LSFDLPVPIV VWENEDESSS LVSDLYDSGK FFLPGVGWHW TVILHDTHPL       180
     LFNLKSYLPL HRFWDGEDLP FYDRLKIALR VGYRF                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page