(data stored in ACNUC7421 zone)

EMBL: CP002116.PE26

CP002116.PE26        Location/Qualifiers
FT   CDS             22389..23273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0026"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: fnu:FN0398 peptide ABC transporter permease; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Putative uncharacterized protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79186"
FT                   /db_xref="GOA:E1R6Q4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q4"
FT                   /protein_id="ADK79186.1"
FT                   /translation="MSSGPKARSLWKETWRRLKKNRLAVAGMLFLITLVLIAIATIVID
FT                   LVMHNAIYNDYVIKQNLRLRLKGPSPEHIFGLDEFGRDIFLRMIWGIRYSLFMGTIAIA
FT                   LSTIAGGILGAIAGYYGKATDNIIMRFMDVLLAIPSMLLATAIVAALGTSLTNLLLAIA
FT                   ISYVPTFARTVRASVLTIKDQEFIEAARALGAGDGRIIFKYIIPNSLAPLIVQATLGVA
FT                   GAILSIAGLSFLGLGIQPPTPEWGSMLSSARSYIREGWHITVIPGLGIMLTILALNVMG
FT                   DGLRDALDPHLKN"
     MSSGPKARSL WKETWRRLKK NRLAVAGMLF LITLVLIAIA TIVIDLVMHN AIYNDYVIKQ        60
     NLRLRLKGPS PEHIFGLDEF GRDIFLRMIW GIRYSLFMGT IAIALSTIAG GILGAIAGYY       120
     GKATDNIIMR FMDVLLAIPS MLLATAIVAA LGTSLTNLLL AIAISYVPTF ARTVRASVLT       180
     IKDQEFIEAA RALGAGDGRI IFKYIIPNSL APLIVQATLG VAGAILSIAG LSFLGLGIQP       240
     PTPEWGSMLS SARSYIREGW HITVIPGLGI MLTILALNVM GDGLRDALDP HLKN             294
//

If you have problems or comments...

PBIL Back to PBIL home page