(data stored in ACNUC7421 zone)

EMBL: CP002116.PE260

CP002116.PE260       Location/Qualifiers
FT   CDS             complement(268436..269101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpi:Cpin_6701 short-chain
FT                   dehydrogenase/reductase SDR; SPTR: Short-chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79420"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAC9"
FT                   /protein_id="ADK79420.1"
FT                   /translation="MGKRVLITGKTTKLGNLLVEHYLSQGWQVVATVKQDEEKRNDTEI
FT                   DSNLLIRTWNRRSPLAAKNVLLGGINHFGGIDEAIIIFPVDGENRPLHELPSAAIEAAI
FT                   DGQIKSQLFMVKEVLAYFQKEKRGQLSLIRNNEGADVLPPLEAICSGSFQALSRSLFTF
FT                   YQNEKVYINSFESSTGDAKGFVDFIMKTLDEKARDQHGKMYRFHDKGVLGALGRNLRK"
     MGKRVLITGK TTKLGNLLVE HYLSQGWQVV ATVKQDEEKR NDTEIDSNLL IRTWNRRSPL        60
     AAKNVLLGGI NHFGGIDEAI IIFPVDGENR PLHELPSAAI EAAIDGQIKS QLFMVKEVLA       120
     YFQKEKRGQL SLIRNNEGAD VLPPLEAICS GSFQALSRSL FTFYQNEKVY INSFESSTGD       180
     AKGFVDFIMK TLDEKARDQH GKMYRFHDKG VLGALGRNLR K                           221
//

If you have problems or comments...

PBIL Back to PBIL home page