(data stored in ACNUC7421 zone)

EMBL: CP002116.PE262

CP002116.PE262       Location/Qualifiers
FT   CDS             complement(270879..274286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0266"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase; InterPro
FT                   IPR006589:IPR006047; KEGG: aba:Acid345_1492 alpha amylase;
FT                   PFAM: alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain; SPTR: Alpha amylase; PFAM: Alpha
FT                   amylase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79422"
FT                   /db_xref="GOA:E1RAD1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAD1"
FT                   /protein_id="ADK79422.1"
FT                   /translation="MSVEKYRKGMPISVKAREQFRIADLFPEQKEGRREKEPGTTYAEA
FT                   QEIAQLLNRKNKADRYPEHRVSTASVFALGLIRTFQYIIIKLYSEKNGGEVSLQLLKHL
FT                   AQSPGRKETESTLSSFETEFFKPSHSARTEEEQIEELLLLWLTNQNRAARFMRGLFSDR
FT                   DLERHTSYQEVIASCYLFFSKLQGFGPGNLHLMDMLRSPAINYPDNLLAQLEYIRDHWG
FT                   PLLGSFLELLLRGIDYLKEEQRPFFPPGPGPSRIPIFRKGSEEYERFSSDSHWMPEVVL
FT                   IAKSTLVWLNQLSRFYHREIHRLDQIPDQELDVLAERGFTALWLIGLWERSDASRKIKQ
FT                   WSGNQEAAASAYSLKRYEIAEELGGWEALDNLRERCRQRGIRLASDMVPNHTGLDSDWL
FT                   FEHPEWFIQCSAPPFPGYTYSGESVVDHPDIEVHLEDHYWDRSDAAVTFQYVDRRSGSC
FT                   RYIYHGNDGTSMPWNDTAQLDYLNPHVREVVIQTILHVARNFPIIRFDAAMTLAKKHIQ
FT                   RLWYPQPGHGGDIPSRSRFGIDETEFHERIPEEFWREVVDRVAAEVPDTLLLAEAFWMM
FT                   EGYFVRTLGMHRVYNSAFMNMLKNEENAKYRQTIKNTLEYDPEILKRFVNFMNNPDEDT
FT                   AYAQFGDGDKYFGVCTMMTAMPGLPMFGHGQIEGFREKYGMEFRKAYLSEEPDRMLIER
FT                   HEREIFPLTRIRSLFAEVEHFNFYDFHETEGRVNENVFVWSNKKGEERAIVAYNNCYQS
FT                   STGSFSESVPVNRRRENGRRELVTGFLAANLDFTSDDNWFLIFQEQRSGLWFIRENKNL
FT                   FGEGFGLILAGYQSQLFLNFREVYDSLGIYRYLCEKLGGSGTKDIERMEKELRAAPVRE
FT                   PFRRLLSKERIAQVEDSFRSGDSSLLTLLDDTIEDYRAFLAGCRQVGYGDAITAAEEEY
FT                   RDQMIRLDLLLACKTEEEPSLPSGAEGYLLRGLSIAPEAAVVLYAKALLTPLWRLLDSK
FT                   AEKAGTFALCDAAEAIEELLLPELFDEALLAVGVAEPFLPELRLLISLLPRLENWTRLT
FT                   LQGSPAERLKQILSIPEVARYCGINEYEGIRWYGGESLQQLFWYLAVLAMPDDRALGYE
FT                   IVRRWHVAEEEADYRLDQLFELLENQAS"
     MSVEKYRKGM PISVKAREQF RIADLFPEQK EGRREKEPGT TYAEAQEIAQ LLNRKNKADR        60
     YPEHRVSTAS VFALGLIRTF QYIIIKLYSE KNGGEVSLQL LKHLAQSPGR KETESTLSSF       120
     ETEFFKPSHS ARTEEEQIEE LLLLWLTNQN RAARFMRGLF SDRDLERHTS YQEVIASCYL       180
     FFSKLQGFGP GNLHLMDMLR SPAINYPDNL LAQLEYIRDH WGPLLGSFLE LLLRGIDYLK       240
     EEQRPFFPPG PGPSRIPIFR KGSEEYERFS SDSHWMPEVV LIAKSTLVWL NQLSRFYHRE       300
     IHRLDQIPDQ ELDVLAERGF TALWLIGLWE RSDASRKIKQ WSGNQEAAAS AYSLKRYEIA       360
     EELGGWEALD NLRERCRQRG IRLASDMVPN HTGLDSDWLF EHPEWFIQCS APPFPGYTYS       420
     GESVVDHPDI EVHLEDHYWD RSDAAVTFQY VDRRSGSCRY IYHGNDGTSM PWNDTAQLDY       480
     LNPHVREVVI QTILHVARNF PIIRFDAAMT LAKKHIQRLW YPQPGHGGDI PSRSRFGIDE       540
     TEFHERIPEE FWREVVDRVA AEVPDTLLLA EAFWMMEGYF VRTLGMHRVY NSAFMNMLKN       600
     EENAKYRQTI KNTLEYDPEI LKRFVNFMNN PDEDTAYAQF GDGDKYFGVC TMMTAMPGLP       660
     MFGHGQIEGF REKYGMEFRK AYLSEEPDRM LIERHEREIF PLTRIRSLFA EVEHFNFYDF       720
     HETEGRVNEN VFVWSNKKGE ERAIVAYNNC YQSSTGSFSE SVPVNRRREN GRRELVTGFL       780
     AANLDFTSDD NWFLIFQEQR SGLWFIRENK NLFGEGFGLI LAGYQSQLFL NFREVYDSLG       840
     IYRYLCEKLG GSGTKDIERM EKELRAAPVR EPFRRLLSKE RIAQVEDSFR SGDSSLLTLL       900
     DDTIEDYRAF LAGCRQVGYG DAITAAEEEY RDQMIRLDLL LACKTEEEPS LPSGAEGYLL       960
     RGLSIAPEAA VVLYAKALLT PLWRLLDSKA EKAGTFALCD AAEAIEELLL PELFDEALLA      1020
     VGVAEPFLPE LRLLISLLPR LENWTRLTLQ GSPAERLKQI LSIPEVARYC GINEYEGIRW      1080
     YGGESLQQLF WYLAVLAMPD DRALGYEIVR RWHVAEEEAD YRLDQLFELL ENQAS           1135
//

If you have problems or comments...

PBIL Back to PBIL home page