(data stored in ACNUC7421 zone)

EMBL: CP002116.PE27

CP002116.PE27        Location/Qualifiers
FT   CDS             23285..24262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0027"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component;
FT                   InterProIPR010066:IPR003593:IPR003439:IPR013563:IPR 017871;
FT                   KEGG: fnu:FN0399 peptide ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Putative uncharacterized protein;
FT                   TIGRFAM: oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter; Oligopeptide/dipeptide
FT                   transporter, C-terminal region; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATP-binding
FT                   protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79187"
FT                   /db_xref="GOA:E1R6Q5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q5"
FT                   /protein_id="ADK79187.1"
FT                   /translation="MDEPLLTVDNLTVNYETDDGIVQALNGVSISVGQGETLGLVGETG
FT                   AGKTTLARGIMRLVPSPPGKIKSGSIMFEGRDLLKLSEAEMRTVRGKSVSMIFQDPMTS
FT                   LNPILSIGEQIQEVIATHNRELSKEKLRKQANDMLELVGISADRAHEFPHQFSGGMKQR
FT                   VIIAIALACNPKLLIADEPTTALDVTIQAQVLDMIRTLKEKMNTAMLLITHDLGVVAQN
FT                   CNRVAVIYAGEIVEMGTIRQIFKNPTHPYTIGLLESIPSLAKKEVHRLNPVKGMMPDPT
FT                   NLPVGCKFNPRCKHAFEPCYGKVPPLTDIGAGQLVRCYLAKERG"
     MDEPLLTVDN LTVNYETDDG IVQALNGVSI SVGQGETLGL VGETGAGKTT LARGIMRLVP        60
     SPPGKIKSGS IMFEGRDLLK LSEAEMRTVR GKSVSMIFQD PMTSLNPILS IGEQIQEVIA       120
     THNRELSKEK LRKQANDMLE LVGISADRAH EFPHQFSGGM KQRVIIAIAL ACNPKLLIAD       180
     EPTTALDVTI QAQVLDMIRT LKEKMNTAML LITHDLGVVA QNCNRVAVIY AGEIVEMGTI       240
     RQIFKNPTHP YTIGLLESIP SLAKKEVHRL NPVKGMMPDP TNLPVGCKFN PRCKHAFEPC       300
     YGKVPPLTDI GAGQLVRCYL AKERG                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page