(data stored in ACNUC7421 zone)

EMBL: CP002116.PE28

CP002116.PE28        Location/Qualifiers
FT   CDS             24264..25232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0028"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component; InterPro
FT                   IPR010066:IPR003593:IPR003439:IPR013563; KEGG:
FT                   aco:Amico_0787 oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Oligopeptide transport ATP-binding
FT                   protein AppF; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter;
FT                   Oligopeptide/dipeptide transporter, C-terminal region;
FT                   TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79188"
FT                   /db_xref="GOA:E1R6Q6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q6"
FT                   /protein_id="ADK79188.1"
FT                   /translation="MAEKQEILRVEHLKKYFDTPSGSLHAVDDLSFSINKGETLGVVGE
FT                   SGCGKSTLGRTILRLHEPTSGNIWFEGREINSCNKREMKNLRKHMQIIFQDPFASLNPR
FT                   MTVGETISESLLIQKLVGRKDKAKLEKEVTELMDMVGIAPRLINSYPHELDGGRRQRVG
FT                   IARVLALRPQFIVCDEPVSALDVSIQAQVLNLMQDLQEEFGFTYLFITHDLSVVKHLSN
FT                   EILVMYLGKMVEKAPASALFANPLHPYTQALLSAIPVPDPDFPVSRILLEGELTSPIDP
FT                   KPGCRFARRCPKATEACLKGDIPFIEVEPNHFAACIMIGKT"
     MAEKQEILRV EHLKKYFDTP SGSLHAVDDL SFSINKGETL GVVGESGCGK STLGRTILRL        60
     HEPTSGNIWF EGREINSCNK REMKNLRKHM QIIFQDPFAS LNPRMTVGET ISESLLIQKL       120
     VGRKDKAKLE KEVTELMDMV GIAPRLINSY PHELDGGRRQ RVGIARVLAL RPQFIVCDEP       180
     VSALDVSIQA QVLNLMQDLQ EEFGFTYLFI THDLSVVKHL SNEILVMYLG KMVEKAPASA       240
     LFANPLHPYT QALLSAIPVP DPDFPVSRIL LEGELTSPID PKPGCRFARR CPKATEACLK       300
     GDIPFIEVEP NHFAACIMIG KT                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page