(data stored in ACNUC7421 zone)

EMBL: CP002116.PE284

CP002116.PE284       Location/Qualifiers
FT   CDS             299458..300246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0288"
FT                   /product="cytochrome c assembly protein"
FT                   /note="COGs: COG0755 ABC-type transport system involved in
FT                   cytochrome c biogenesis permease component; InterPro
FT                   IPR002541; KEGG: gsu:GSU3283 CcmF/CcyK/CcsA family
FT                   cytochrome c biogenesis protein; PFAM: cytochrome c
FT                   assembly protein; SPTR: Cytochrome c biogenesis protein,
FT                   CcmF/CcyK/CcsA family; PFAM: Cytochrome C assembly protein;
FT                   TIGRFAM: cytochrome c-type biogenesis protein CcsB"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79444"
FT                   /db_xref="GOA:E1RAF3"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAF3"
FT                   /protein_id="ADK79444.1"
FT                   /translation="MNATLSFFLFLAATAVSACSLFTKRATSFCDLIARILAAIAVIWL
FT                   FILLLWRSFSIGFPALTGMYEGLTFFSGAVGGLTLCMIRKGEQASRMIRLWGFLVAAIL
FT                   LALASSPLAPSSLSYPVPALRSGWLVLHVSFSFLGEAAFTVSFAAAITWFLARQPETKN
FT                   RAEAVASAAVALGYPVYTLGALLFGAIWAQYAWGRFWGWDPKEIWALVTWLVYTLYLHV
FT                   RLGKKRRGAFPMAVLVLGFALTLFTFLGVNFLASGLHSYR"
     MNATLSFFLF LAATAVSACS LFTKRATSFC DLIARILAAI AVIWLFILLL WRSFSIGFPA        60
     LTGMYEGLTF FSGAVGGLTL CMIRKGEQAS RMIRLWGFLV AAILLALASS PLAPSSLSYP       120
     VPALRSGWLV LHVSFSFLGE AAFTVSFAAA ITWFLARQPE TKNRAEAVAS AAVALGYPVY       180
     TLGALLFGAI WAQYAWGRFW GWDPKEIWAL VTWLVYTLYL HVRLGKKRRG AFPMAVLVLG       240
     FALTLFTFLG VNFLASGLHS YR                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page