(data stored in ACNUC7421 zone)

EMBL: CP002116.PE29

CP002116.PE29        Location/Qualifiers
FT   CDS             25281..26810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0029"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COGs: COG0747 ABC-type dipeptide transport system
FT                   periplasmic component; InterPro IPR000914; KEGG: fnu:FN0396
FT                   dipeptide-binding protein; PFAM: extracellular
FT                   solute-binding protein family 5; SPTR: Putative
FT                   uncharacterized protein; PFAM: Bacterial extracellular
FT                   solute-binding proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79189"
FT                   /db_xref="GOA:E1R6Q7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q7"
FT                   /protein_id="ADK79189.1"
FT                   /translation="MKKALTCLLFLLIACSFVFANGASEASAASGGYKDTITFAQGADV
FT                   TSFDPHIGKETPAVAVTNHIYDTLVDIDSVSGEVVPQIAERWEQISDVSYRFFIRKGLK
FT                   FHNGEDLTADDVKFSLDRAIASAAVSYIVDFIKDVKIEDDYTVVVTTKAPYAPALRNLA
FT                   VPFAAIVPKDYVEANPDILKTKPVGSGPYKFVSWAQSDSCKLEAFDDYYAGAPKTKYLV
FT                   MKVIPEAAQRTIALETGEVDLSYDILTSDLKRVRENEKLTLYEAPSLTCFYISMNMRKK
FT                   PFDNKLVRQAINYAIDRQLLVDTVNSGTGAPADAIIAPAVFGYYSPGQYDYNPEKAKKL
FT                   LAEAGYPNGFSCSLWVNNNQTRVEMCQAIQEMLREVGITCKIEVMEFGAFISRSTSGEH
FT                   DMAYFGWVTSTKDADYTYYSLEHSSQQGAAGNRTFIADPEVDRLIELARTNTDTDTRRE
FT                   AYKDLAILLKDIANNAPIIYTAITAGSSNKVENFALDPIGYHKLEGVTVHN"
     MKKALTCLLF LLIACSFVFA NGASEASAAS GGYKDTITFA QGADVTSFDP HIGKETPAVA        60
     VTNHIYDTLV DIDSVSGEVV PQIAERWEQI SDVSYRFFIR KGLKFHNGED LTADDVKFSL       120
     DRAIASAAVS YIVDFIKDVK IEDDYTVVVT TKAPYAPALR NLAVPFAAIV PKDYVEANPD       180
     ILKTKPVGSG PYKFVSWAQS DSCKLEAFDD YYAGAPKTKY LVMKVIPEAA QRTIALETGE       240
     VDLSYDILTS DLKRVRENEK LTLYEAPSLT CFYISMNMRK KPFDNKLVRQ AINYAIDRQL       300
     LVDTVNSGTG APADAIIAPA VFGYYSPGQY DYNPEKAKKL LAEAGYPNGF SCSLWVNNNQ       360
     TRVEMCQAIQ EMLREVGITC KIEVMEFGAF ISRSTSGEHD MAYFGWVTST KDADYTYYSL       420
     EHSSQQGAAG NRTFIADPEV DRLIELARTN TDTDTRREAY KDLAILLKDI ANNAPIIYTA       480
     ITAGSSNKVE NFALDPIGYH KLEGVTVHN                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page