(data stored in ACNUC7421 zone)

EMBL: CP002116.PE3

CP002116.PE3         Location/Qualifiers
FT   CDS             1768..2871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0003"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: tde:TDE0231 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta subunit, C-terminal domain; DNA
FT                   polymerase III beta subunit, N-terminal domain; DNA
FT                   polymerase III beta subunit, central domain; TIGRFAM: DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79163"
FT                   /db_xref="GOA:E1R6N1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6N1"
FT                   /protein_id="ADK79163.1"
FT                   /translation="MKFTCEKNALLKEISIAQEIISTRNALSILSNVLLEADDGSLTIK
FT                   ATDLKVSFETRIPVEIAAPGSTTVFCDKFLGILRSLPEGDIEVELVDNRVMIRPLFQKI
FT                   NFQLKSIAGDKFPELQEVSEDLYFEIPQKDLIEMIGQTIFAVSDDETRYYMNGVYVEQD
FT                   GESISMVATDGRRLSLIKRRIESELKEFDAVIIPPKVLQLIRKLSSGEGNLKIAISDRN
FT                   IFVQFDDQRITSNLIEGQFPNYRRVIPDSQDYQLVVNRDQLEEALKRVSLLVEQKSRRV
FT                   YLSVENAMMRLTSEESDIGVAKEELSCSYEGPETTIALNYLYLAEPLKVMRCEEVVLRF
FT                   TEANKAITLEPVPEGDYFHIIMPMQLD"
     MKFTCEKNAL LKEISIAQEI ISTRNALSIL SNVLLEADDG SLTIKATDLK VSFETRIPVE        60
     IAAPGSTTVF CDKFLGILRS LPEGDIEVEL VDNRVMIRPL FQKINFQLKS IAGDKFPELQ       120
     EVSEDLYFEI PQKDLIEMIG QTIFAVSDDE TRYYMNGVYV EQDGESISMV ATDGRRLSLI       180
     KRRIESELKE FDAVIIPPKV LQLIRKLSSG EGNLKIAISD RNIFVQFDDQ RITSNLIEGQ       240
     FPNYRRVIPD SQDYQLVVNR DQLEEALKRV SLLVEQKSRR VYLSVENAMM RLTSEESDIG       300
     VAKEELSCSY EGPETTIALN YLYLAEPLKV MRCEEVVLRF TEANKAITLE PVPEGDYFHI       360
     IMPMQLD                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page