(data stored in ACNUC7421 zone)

EMBL: CP002116.PE30

CP002116.PE30        Location/Qualifiers
FT   CDS             26872..27633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0030"
FT                   /product="Creatininase"
FT                   /note="COGs: COG1402 Uncharacterized protein putative
FT                   amidase; InterPro IPR003785:IPR019775; KEGG: aco:Amico_0022
FT                   creatininase; PFAM: Creatininase; SPTR: Putative
FT                   uncharacterized protein; PFAM: Creatinine amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79190"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q8"
FT                   /protein_id="ADK79190.1"
FT                   /translation="MLLSEMTWPQAEKYFKESDLVIIPIGSIECHGKHMPLGTDTLIPD
FT                   KIIELLRRQEDRFLIAPTIPYGACESLYPFPGTVNLGTDLLYELMKTIVENLKRHGAKK
FT                   FVVLNGHGGNIKALERIGYELDADGCLMAILNWWLNVWEMNPEWKGGHGGGEETAAVMA
FT                   IDPDLVDRSYIDLPLEITDLSDTIKGSGFNTVQYDNITVTIPRLTNHVTSNGWIGPDHP
FT                   KYATVEWGSEMLQTFTNFMVSFLKEFEKVEL"
     MLLSEMTWPQ AEKYFKESDL VIIPIGSIEC HGKHMPLGTD TLIPDKIIEL LRRQEDRFLI        60
     APTIPYGACE SLYPFPGTVN LGTDLLYELM KTIVENLKRH GAKKFVVLNG HGGNIKALER       120
     IGYELDADGC LMAILNWWLN VWEMNPEWKG GHGGGEETAA VMAIDPDLVD RSYIDLPLEI       180
     TDLSDTIKGS GFNTVQYDNI TVTIPRLTNH VTSNGWIGPD HPKYATVEWG SEMLQTFTNF       240
     MVSFLKEFEK VEL                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page