(data stored in ACNUC7421 zone)

EMBL: CP002116.PE303

CP002116.PE303       Location/Qualifiers
FT   CDS             316826..318184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0307"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   tpp:TPASS_0074 sugar ABC transporter, periplasmic binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   1; SPTR: Sugar ABC transporter, periplasmic binding protein
FT                   (Y4oP); PFAM: Bacterial extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79463"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAH2"
FT                   /protein_id="ADK79463.1"
FT                   /translation="MRRFVVVLLLIFTSSFVFSNGQQDAAGSSPKSVSGEFNWRQCEGE
FT                   TIVTCFPNHVTYNALMPLIPEFEELTGIKVEVDLLQYMKMHDKQVLEMSKPSGDYDLIS
FT                   MVCMWKSEYAAAGMLKELEPFFNDPSLAYPDYDFDDLVPAYVENTGYVGGKKIYLGGPG
FT                   AKLYGVPFGAETSILIYRKDIFDKYNLKVPETYDEVLETAKFIYENVDGMYGMTSRGAS
FT                   GHQANAAYLLHASPFGARVFDENWEPVVNSPESIKTLEWMKKMFSYGPPGMTSFAQDGE
FT                   FQAFLQGDVAMYLDASVFAGKARDPKQSKVYDKLGYAMHPKQENRLSESGGFGLAIPAN
FT                   ASHPEAAFLFLQWITSKETERKVIENGGAPFRTSSVNDPILQDEYPEFKALALQLPHVN
FT                   PDWRPIIPEWGEIDNIMGIAVNQVLTGEKEPQEAMDGIMAPIREIMVRAGYIK"
     MRRFVVVLLL IFTSSFVFSN GQQDAAGSSP KSVSGEFNWR QCEGETIVTC FPNHVTYNAL        60
     MPLIPEFEEL TGIKVEVDLL QYMKMHDKQV LEMSKPSGDY DLISMVCMWK SEYAAAGMLK       120
     ELEPFFNDPS LAYPDYDFDD LVPAYVENTG YVGGKKIYLG GPGAKLYGVP FGAETSILIY       180
     RKDIFDKYNL KVPETYDEVL ETAKFIYENV DGMYGMTSRG ASGHQANAAY LLHASPFGAR       240
     VFDENWEPVV NSPESIKTLE WMKKMFSYGP PGMTSFAQDG EFQAFLQGDV AMYLDASVFA       300
     GKARDPKQSK VYDKLGYAMH PKQENRLSES GGFGLAIPAN ASHPEAAFLF LQWITSKETE       360
     RKVIENGGAP FRTSSVNDPI LQDEYPEFKA LALQLPHVNP DWRPIIPEWG EIDNIMGIAV       420
     NQVLTGEKEP QEAMDGIMAP IREIMVRAGY IK                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page