(data stored in ACNUC7421 zone)

EMBL: CP002116.PE31

CP002116.PE31        Location/Qualifiers
FT   CDS             27640..28716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0031"
FT                   /product="Glutamyl aminopeptidase"
FT                   /EC_number="3.4.11.7"
FT                   /note="COGs: COG1363 Cellulase M and related protein;
FT                   InterPro IPR008007; KEGG: efa:EF2724 M42 family peptidase;
FT                   PFAM: peptidase M42 family protein; PRIAM: Glutamyl
FT                   aminopeptidase; SPTR: Putative uncharacterized protein;
FT                   PFAM: M42 glutamyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79191"
FT                   /db_xref="GOA:E1R6Q9"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6Q9"
FT                   /protein_id="ADK79191.1"
FT                   /translation="MDKQASIRRIQRLSDANGISGFEDAVVELIRQEAEDLGNFSEDSL
FT                   RNLYLERSGNGKDRPVLLLDAHTDEVGFMVKAIRPDGMLEFITIGGWVPFNIPAHLVRV
FT                   RNRDGLYIPGVVASKPPHFLTEAERKAPLEVRDLVIDVGASSAEEIEHEYLIEIAAPVV
FT                   PDAHCSYDEVHDILMGKAFDNRLGCAAVVSAMEELRGDELPLNIVGAFASQEEVGTRGA
FT                   AVTAQRVTPDLAIVFEGCPADDTVVPAYQAQTVLKRGPMLRHIDARMITNPRFQRYALD
FT                   IAKREAIPVQRAVRTGGATNGAPIHLSNQGVPAIVVGIPVRYAHTHYGISSYSDFAHGV
FT                   ELAVKIIRNITHDIIAGF"
     MDKQASIRRI QRLSDANGIS GFEDAVVELI RQEAEDLGNF SEDSLRNLYL ERSGNGKDRP        60
     VLLLDAHTDE VGFMVKAIRP DGMLEFITIG GWVPFNIPAH LVRVRNRDGL YIPGVVASKP       120
     PHFLTEAERK APLEVRDLVI DVGASSAEEI EHEYLIEIAA PVVPDAHCSY DEVHDILMGK       180
     AFDNRLGCAA VVSAMEELRG DELPLNIVGA FASQEEVGTR GAAVTAQRVT PDLAIVFEGC       240
     PADDTVVPAY QAQTVLKRGP MLRHIDARMI TNPRFQRYAL DIAKREAIPV QRAVRTGGAT       300
     NGAPIHLSNQ GVPAIVVGIP VRYAHTHYGI SSYSDFAHGV ELAVKIIRNI THDIIAGF         358
//

If you have problems or comments...

PBIL Back to PBIL home page