(data stored in ACNUC7421 zone)

EMBL: CP002116.PE315

CP002116.PE315       Location/Qualifiers
FT   CDS             complement(328340..328570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0319"
FT                   /product="glutaredoxin-like protein, YruB-family"
FT                   /note="COGs: COG0695 Glutaredoxin and related protein;
FT                   InterPro IPR002109:IPR011911; KEGG: dtu:Dtur_0034
FT                   glutaredoxin-like protein, YruB-family; PFAM: glutaredoxin;
FT                   SPTR: Glutaredoxin-like protein, YruB-family; TIGRFAM:
FT                   glutaredoxin-like protein, YruB-family; PFAM: Glutaredoxin;
FT                   TIGRFAM: Glutaredoxin-like protein, YruB-family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79475"
FT                   /db_xref="GOA:E1RAU5"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011911"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAU5"
FT                   /protein_id="ADK79475.1"
FT                   /translation="MAITIYTTPSCGYCVKAKEYFRGRGVNFTEYNVAQNMQKAEEMVK
FT                   KSGQMGVPVIDINGRIIIGFNQSEIERALHR"
     MAITIYTTPS CGYCVKAKEY FRGRGVNFTE YNVAQNMQKA EEMVKKSGQM GVPVIDINGR        60
     IIIGFNQSEI ERALHR                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page