(data stored in ACNUC7421 zone)

EMBL: CP002116.PE32

CP002116.PE32        Location/Qualifiers
FT   CDS             28718..29767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_4032 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79192"
FT                   /db_xref="GOA:E1R6R0"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R0"
FT                   /protein_id="ADK79192.1"
FT                   /translation="MGIGRMFPLEAVGNKRQEYPASLGSDVCFCMSGRCAIYACLLDFL
FT                   PSDSRRVVYAPAYTCETVLASYLKAGYSCRFYDIDPEGLRPRFREEELDEVSLLSLCGY
FT                   YGVSTYDREFVRRCAERGIVIIHDTTHTPFQPDPAADYIAGSMRKWMGIACGGIAAKRK
FT                   GHFSISPLPVDPEHLAGRYASLELAGKAQKGDLHASSEASSVFWETELALRKSFDAYGS
FT                   DEQSRRILEYYPYDDMIARRRANYGLLLGLLGPPTGWAPVFPLLPENATPSHFSLYADD
FT                   REDLRSFLAQRDVATTVYWPIPPMIGDISSYPGAEWIYNHICSIQIDQRYGAEDMRLLA
FT                   SCLNAYSRI"
     MGIGRMFPLE AVGNKRQEYP ASLGSDVCFC MSGRCAIYAC LLDFLPSDSR RVVYAPAYTC        60
     ETVLASYLKA GYSCRFYDID PEGLRPRFRE EELDEVSLLS LCGYYGVSTY DREFVRRCAE       120
     RGIVIIHDTT HTPFQPDPAA DYIAGSMRKW MGIACGGIAA KRKGHFSISP LPVDPEHLAG       180
     RYASLELAGK AQKGDLHASS EASSVFWETE LALRKSFDAY GSDEQSRRIL EYYPYDDMIA       240
     RRRANYGLLL GLLGPPTGWA PVFPLLPENA TPSHFSLYAD DREDLRSFLA QRDVATTVYW       300
     PIPPMIGDIS SYPGAEWIYN HICSIQIDQR YGAEDMRLLA SCLNAYSRI                   349
//

If you have problems or comments...

PBIL Back to PBIL home page