(data stored in ACNUC7421 zone)

EMBL: CP002116.PE329

CP002116.PE329       Location/Qualifiers
FT   CDS             342641..344068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0333"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_3958 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79489"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAV9"
FT                   /protein_id="ADK79489.1"
FT                   /translation="MTFGPDLLIRCPGCRNIYIRNSVGSENSLGARYWSDGWNDAPMMP
FT                   IPPLVAWCEWCHTWFFIEDAEPLVELPFGTEPGEHKVIPVSDSLDVEAYRSVLKQSWSK
FT                   EREILLRIRLMWGYNHMLRQDRYRKDPATVESHDNLERLADLLDPNRDLLMLAEVHREL
FT                   GEFPRAKEFAIAVIEAESEELNRTWAMRIIRESERRNIFPVQLNDDELFYHENLLFPEC
FT                   IDAGYYPLPEWEDVFAFADEKKMELTHPFVSVHFSLVGLQGDGWATFFEDGHSSWHYRY
FT                   DRLFTQEEWRFFLSLSEGARNELIDFWEMKSYQCDQFNQYELNFYYRTLFRLHYGYRQP
FT                   LEKELYDAHFRKYRKAWAGIRASLSLEEGAPEELLLYWRFFWESFTGRCKLSQIKAELV
FT                   DKMSSDLAEAQKLVNRRRDFLLNHIDTFEFGDEISDASPRYIGRIPGEFFEKALPGMCS
FT                   LYFDEEESRFEQYHDEG"
     MTFGPDLLIR CPGCRNIYIR NSVGSENSLG ARYWSDGWND APMMPIPPLV AWCEWCHTWF        60
     FIEDAEPLVE LPFGTEPGEH KVIPVSDSLD VEAYRSVLKQ SWSKEREILL RIRLMWGYNH       120
     MLRQDRYRKD PATVESHDNL ERLADLLDPN RDLLMLAEVH RELGEFPRAK EFAIAVIEAE       180
     SEELNRTWAM RIIRESERRN IFPVQLNDDE LFYHENLLFP ECIDAGYYPL PEWEDVFAFA       240
     DEKKMELTHP FVSVHFSLVG LQGDGWATFF EDGHSSWHYR YDRLFTQEEW RFFLSLSEGA       300
     RNELIDFWEM KSYQCDQFNQ YELNFYYRTL FRLHYGYRQP LEKELYDAHF RKYRKAWAGI       360
     RASLSLEEGA PEELLLYWRF FWESFTGRCK LSQIKAELVD KMSSDLAEAQ KLVNRRRDFL       420
     LNHIDTFEFG DEISDASPRY IGRIPGEFFE KALPGMCSLY FDEEESRFEQ YHDEG            475
//

If you have problems or comments...

PBIL Back to PBIL home page