(data stored in ACNUC7421 zone)

EMBL: CP002116.PE33

CP002116.PE33        Location/Qualifiers
FT   CDS             complement(29771..31648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0033"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004090:IPR003660:IPR004089; KEGG: dde:Dde_0347
FT                   methyl-accepting chemotaxis sensory transducer; PFAM:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein; SMART: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SPTR:
FT                   Methyl-accepting chemotaxis sensory transducer; PFAM: HAMP
FT                   domain; Protein of unknown function (DUF3365);
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79193"
FT                   /db_xref="GOA:E1R6R1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R1"
FT                   /protein_id="ADK79193.1"
FT                   /translation="MTRFKDIPITAKILTITLLGIVTLSVIFSVVFTNAIGSQAEKAIL
FT                   EKSHAVVYTAEAARENMAHKINMGVIRNFDDLAAEGDRDKLLEAVPIITAISIAKENAE
FT                   KANYQFRVPKVSPRNPENEPTELEAKVLEELKAKGLEEKVIYEENQIRYFRPIKLTQEC
FT                   LLCHGSPAGTPDPIGGIKEGWQVGEIHGAFEIISSLEAAKATTTKAAIQITLLSLSIMF
FT                   LLGLFLWFSIKMITRPLKDYIQNFEAVSAGDLTVSSGVDSRDEIGQLSDYFNKFVSSLH
FT                   GMILDIGKVTRNTRSISEDLASSSTETAAAVEEIRANSDQMKNQMHHLDKEVHSSKSSA
FT                   DEVRVFIQRVNEQIQSQASAITESSASIEEMSASINSIAHSSAEKLKIAEELEHTSEQG
FT                   SSEMGITREVMKKVAESADVMMEMIEVIDAIASQTNLLAMNAAIEAAHAGEAGKGFGVV
FT                   ADEIRNLAESSSNSAKEISKSLKEVIENISVTDKSTERTGEMFDRMLQMIKEVSRSMNE
FT                   MQNATQELSIGSGQIVEALGSLVQITQDVQNSSGEMDQKVAAITSSLETLQNISAESTA
FT                   GMEEMALGILEIAQAAQNVSNAGDQNSGSVRELEELVARFQVREEKNEE"
     MTRFKDIPIT AKILTITLLG IVTLSVIFSV VFTNAIGSQA EKAILEKSHA VVYTAEAARE        60
     NMAHKINMGV IRNFDDLAAE GDRDKLLEAV PIITAISIAK ENAEKANYQF RVPKVSPRNP       120
     ENEPTELEAK VLEELKAKGL EEKVIYEENQ IRYFRPIKLT QECLLCHGSP AGTPDPIGGI       180
     KEGWQVGEIH GAFEIISSLE AAKATTTKAA IQITLLSLSI MFLLGLFLWF SIKMITRPLK       240
     DYIQNFEAVS AGDLTVSSGV DSRDEIGQLS DYFNKFVSSL HGMILDIGKV TRNTRSISED       300
     LASSSTETAA AVEEIRANSD QMKNQMHHLD KEVHSSKSSA DEVRVFIQRV NEQIQSQASA       360
     ITESSASIEE MSASINSIAH SSAEKLKIAE ELEHTSEQGS SEMGITREVM KKVAESADVM       420
     MEMIEVIDAI ASQTNLLAMN AAIEAAHAGE AGKGFGVVAD EIRNLAESSS NSAKEISKSL       480
     KEVIENISVT DKSTERTGEM FDRMLQMIKE VSRSMNEMQN ATQELSIGSG QIVEALGSLV       540
     QITQDVQNSS GEMDQKVAAI TSSLETLQNI SAESTAGMEE MALGILEIAQ AAQNVSNAGD       600
     QNSGSVRELE ELVARFQVRE EKNEE                                             625
//

If you have problems or comments...

PBIL Back to PBIL home page