(data stored in ACNUC7421 zone)

EMBL: CP002116.PE330

CP002116.PE330       Location/Qualifiers
FT   CDS             complement(344053..345216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0334"
FT                   /product="Capsule synthesis protein, CapA"
FT                   /note="COGs: COG2843 Putative protein of
FT                   poly-gamma-glutamate biosynthesis (capsule formation);
FT                   InterPro IPR019079; KEGG: tde:TDE1500 hypothetical protein;
FT                   PFAM: Capsule synthesis protein, CapA; SPTR: Putative
FT                   uncharacterized protein; PFAM: Bacterial capsule synthesis
FT                   protein PGA_cap"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79490"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAW0"
FT                   /protein_id="ADK79490.1"
FT                   /translation="MRIIGRIAAIFTALVLINGATIILTEYGHKAPHLPPPQERMAPPE
FT                   SITLLFAGDLMAHNVNFNMADYTDIYQEMKPAIEHADLAFINLETPVYEKAPYTSFPRF
FT                   NVHQDYVQAAVDAGFDIFALANNHSADQEAPGIIATLELMRKLAAEEGIAYSGLRMHQR
FT                   SPITPTTVKAGNWTIGFISITSFINVWSGHELIYLTDYYRNEALRRAFSDYIRTIRPLY
FT                   QILVVAVHDGAEYSNTPLERKKVFFRELAEAGADVVWGNHSHVLQPWERFTKKDGTTAV
FT                   LIYSMGNFISGQTWNIDPDDYKNEKNATGDSCLLNITFTKEPGKKAIPRSITPYLAFNY
FT                   RDPVKGMIVRPYDKIIGDEGVPKAWKDFYRERKRLLSWFLRPDQPSS"
     MRIIGRIAAI FTALVLINGA TIILTEYGHK APHLPPPQER MAPPESITLL FAGDLMAHNV        60
     NFNMADYTDI YQEMKPAIEH ADLAFINLET PVYEKAPYTS FPRFNVHQDY VQAAVDAGFD       120
     IFALANNHSA DQEAPGIIAT LELMRKLAAE EGIAYSGLRM HQRSPITPTT VKAGNWTIGF       180
     ISITSFINVW SGHELIYLTD YYRNEALRRA FSDYIRTIRP LYQILVVAVH DGAEYSNTPL       240
     ERKKVFFREL AEAGADVVWG NHSHVLQPWE RFTKKDGTTA VLIYSMGNFI SGQTWNIDPD       300
     DYKNEKNATG DSCLLNITFT KEPGKKAIPR SITPYLAFNY RDPVKGMIVR PYDKIIGDEG       360
     VPKAWKDFYR ERKRLLSWFL RPDQPSS                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page