(data stored in ACNUC7421 zone)

EMBL: CP002116.PE339

CP002116.PE339       Location/Qualifiers
FT   CDS             351509..352633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0343"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="COGs: COG0683 ABC-type branched-chain amino acid
FT                   transport systems periplasmic component; InterPro
FT                   IPR000709:IPR001828; KEGG: dal:Dalk_4388 extracellular
FT                   ligand-binding receptor; PFAM: Extracellular ligand-binding
FT                   receptor; SPTR: Extracellular ligand-binding receptor;
FT                   PFAM: Receptor family ligand binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79499"
FT                   /db_xref="GOA:E1RAW9"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAW9"
FT                   /protein_id="ADK79499.1"
FT                   /translation="MRRGRIFLILLIVFLTLGMVSCKKKDSDTIKIGVAGAHSGDLASY
FT                   GLPTVKAAELVVKDANANGGILGRQVELVVEDDVCKPEVATNTASKLVGEKVVGVIGHI
FT                   CSGATKAALGIYKDSNIFAISPSATNPPLTQSGDYPNFFRTIASDDAQARLEVDFALDT
FT                   LGLTKIAVLHDKGDYGKGLAEFAKGFLENDDRAEVVLYEGVTPGAVDYTAVINKIEASG
FT                   AQAIIFGGYHPEASKIVAQMRKAGMDIAFISDDGVKDDTFIKVAGEYAEGVYATGPKDT
FT                   TSNPLAKKAIKEHQDAYGEDPGAFYLNAYAATLAVLNAIEAAGATDYDAVTNALRTEWV
FT                   ETPLGKIRFDEKGDAIGIGFSMYQVRNGAYVEIE"
     MRRGRIFLIL LIVFLTLGMV SCKKKDSDTI KIGVAGAHSG DLASYGLPTV KAAELVVKDA        60
     NANGGILGRQ VELVVEDDVC KPEVATNTAS KLVGEKVVGV IGHICSGATK AALGIYKDSN       120
     IFAISPSATN PPLTQSGDYP NFFRTIASDD AQARLEVDFA LDTLGLTKIA VLHDKGDYGK       180
     GLAEFAKGFL ENDDRAEVVL YEGVTPGAVD YTAVINKIEA SGAQAIIFGG YHPEASKIVA       240
     QMRKAGMDIA FISDDGVKDD TFIKVAGEYA EGVYATGPKD TTSNPLAKKA IKEHQDAYGE       300
     DPGAFYLNAY AATLAVLNAI EAAGATDYDA VTNALRTEWV ETPLGKIRFD EKGDAIGIGF       360
     SMYQVRNGAY VEIE                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page