(data stored in ACNUC7421 zone)

EMBL: CP002116.PE34

CP002116.PE34        Location/Qualifiers
FT   CDS             complement(31684..33150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0034"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /note="COGs: COG2195 Di- and tripeptidase; InterPro
FT                   IPR001160:IPR002933:IPR011650; KEGG: bfs:BF3079 putative
FT                   aminoacyl-histidine dipeptidase; PFAM: peptidase
FT                   dimerisation domain protein; peptidase M20; PRIAM: Xaa-His
FT                   dipeptidase; SPTR: Aminoacyl-histidine dipeptidase;
FT                   TIGRFAM: aminoacyl-histidine dipeptidase; PFAM: Peptidase
FT                   family M20/M25/M40; Peptidase dimerisation domain; TIGRFAM:
FT                   aminoacyl-histidine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79194"
FT                   /db_xref="GOA:E1R6R2"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R2"
FT                   /protein_id="ADK79194.1"
FT                   /translation="MNNNPLEGRKPASVWHYFQTISKIPRCSCNEAAVRDYVRQFAEEH
FT                   HMAWKIDAAGNIAVKKGASVGKEAHPGVVLQGHLDMVCEKNRTTKHDFTVDPIKLVVDG
FT                   DWLKADGTTLGADNGIAVAMALAVLASDEISHGPIEVLFTVDEETGLTGAMGLDPSIIE
FT                   GKILLNLDSEEPGVFYIGCAGGVNTEGMLPITSEAVPQGRVCYTLTIEGLQGGHSGGEI
FT                   HLGRGNAIDLVGRLLWELRKLGDFNLVSINGGGKHNAIPRECHARFTLSKEKVAEAEKL
FT                   AKTIGREIKAELGDNAPGFNLIFEKDTEADEQFDPSSTDRICYMLRIMPHGVAAMSRSI
FT                   EGLVETSTNFAAIETQKDCCSTTVKVLTSQRSSIMSALDDIAAKVNAAICVVGGQVRHY
FT                   SRYPAWTPNPNSKLLAECKRIYRDFTGEEAVHAAIHAGLECGVIGDKLEGMEMISFGPE
FT                   MLGVHTPEERLNIPSVEKLWGFLIKLLENV"
     MNNNPLEGRK PASVWHYFQT ISKIPRCSCN EAAVRDYVRQ FAEEHHMAWK IDAAGNIAVK        60
     KGASVGKEAH PGVVLQGHLD MVCEKNRTTK HDFTVDPIKL VVDGDWLKAD GTTLGADNGI       120
     AVAMALAVLA SDEISHGPIE VLFTVDEETG LTGAMGLDPS IIEGKILLNL DSEEPGVFYI       180
     GCAGGVNTEG MLPITSEAVP QGRVCYTLTI EGLQGGHSGG EIHLGRGNAI DLVGRLLWEL       240
     RKLGDFNLVS INGGGKHNAI PRECHARFTL SKEKVAEAEK LAKTIGREIK AELGDNAPGF       300
     NLIFEKDTEA DEQFDPSSTD RICYMLRIMP HGVAAMSRSI EGLVETSTNF AAIETQKDCC       360
     STTVKVLTSQ RSSIMSALDD IAAKVNAAIC VVGGQVRHYS RYPAWTPNPN SKLLAECKRI       420
     YRDFTGEEAV HAAIHAGLEC GVIGDKLEGM EMISFGPEML GVHTPEERLN IPSVEKLWGF       480
     LIKLLENV                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page