(data stored in ACNUC7421 zone)

EMBL: CP002116.PE347

CP002116.PE347       Location/Qualifiers
FT   CDS             complement(360046..360723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0351"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="COGs: COG0765 ABC-type amino acid transport system
FT                   permease component; InterPro IPR000515:IPR010065; KEGG:
FT                   spl:Spea_3398 polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: Polar amino acid
FT                   ABC transporter, inner membrane subunit; TIGRFAM: polar
FT                   amino acid ABC transporter, inner membrane subunit; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component; TIGRFAM: amine acid ABC transporter, permease
FT                   protein, 3-TM region, His/Glu/Gln/Arg/opine family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79507"
FT                   /db_xref="GOA:E1RAX7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1RAX7"
FT                   /protein_id="ADK79507.1"
FT                   /translation="MESIRRTLFQTLWEGGPDGLHLLLNGLKVTIVVTLFAITAGVILG
FT                   TLLALMRLSKNKVANIISKLYVEIIRGTPVLVQLLIIYFVIFRALDVDKTMASSLAFGI
FT                   NSGAYVAEIIRAGIQAVDKGQMEAARSLGLPHRLAMKEIILPQAIKNILPALGNEFIVL
FT                   LKETSIIGFIGGNDLMRAGNKIRSITYEATVPLFATAVIYLIITLSLSHLLNRYERRLH
FT                   SSD"
     MESIRRTLFQ TLWEGGPDGL HLLLNGLKVT IVVTLFAITA GVILGTLLAL MRLSKNKVAN        60
     IISKLYVEII RGTPVLVQLL IIYFVIFRAL DVDKTMASSL AFGINSGAYV AEIIRAGIQA       120
     VDKGQMEAAR SLGLPHRLAM KEIILPQAIK NILPALGNEF IVLLKETSII GFIGGNDLMR       180
     AGNKIRSITY EATVPLFATA VIYLIITLSL SHLLNRYERR LHSSD                       225
//

If you have problems or comments...

PBIL Back to PBIL home page