(data stored in ACNUC7421 zone)

EMBL: CP002116.PE35

CP002116.PE35        Location/Qualifiers
FT   CDS             33396..34613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Spirs_0035"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="InterPro IPR001647; KEGG: reh:H16_B0715 TetR/AcrR
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   TetR; SPTR: Transcriptional regulator, TetR/AcrR-family;
FT                   PFAM: Bacterial regulatory proteins, tetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Spirs_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADK79195"
FT                   /db_xref="GOA:E1R6R3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:E1R6R3"
FT                   /protein_id="ADK79195.1"
FT                   /translation="MTDKQKRRREEIIETAFRVWSESSFKKTSLSAVATRMGISKTALY
FT                   RYFSGKEALLQAMEEYFLRLYNHLCDEVIRHRDERSVAEALEAYNRIFVGFFARNSHYL
FT                   RFAQIRFIRKPQVGDSFLAMTFRRNMDLFPAEPLAREFGWRMAQIPVIVRYILSVSNFL
FT                   LAVEHCGNEEIAGGAESLLEVNRRLIISGISLNRDRQIPDFQMIEERCILSEGDFPETD
FT                   RVTYAVSEVVAENGLWNTTVEKIAHRLGMSKSSLYFYFENRDEMLWKLIEQERQAFGAL
FT                   VIRDIEPMESFSDQLYAYFVLHARYLWGRPEFLATMNWYRFQDIAFHPPEDPISSVIRF
FT                   YRFVEEAVEAGVMSEKVPLLSFLRLLNFLLMQELSEHFRRGNDFNQLFPILRTLHQLLL
FT                   YGVQGA"
     MTDKQKRRRE EIIETAFRVW SESSFKKTSL SAVATRMGIS KTALYRYFSG KEALLQAMEE        60
     YFLRLYNHLC DEVIRHRDER SVAEALEAYN RIFVGFFARN SHYLRFAQIR FIRKPQVGDS       120
     FLAMTFRRNM DLFPAEPLAR EFGWRMAQIP VIVRYILSVS NFLLAVEHCG NEEIAGGAES       180
     LLEVNRRLII SGISLNRDRQ IPDFQMIEER CILSEGDFPE TDRVTYAVSE VVAENGLWNT       240
     TVEKIAHRLG MSKSSLYFYF ENRDEMLWKL IEQERQAFGA LVIRDIEPME SFSDQLYAYF       300
     VLHARYLWGR PEFLATMNWY RFQDIAFHPP EDPISSVIRF YRFVEEAVEA GVMSEKVPLL       360
     SFLRLLNFLL MQELSEHFRR GNDFNQLFPI LRTLHQLLLY GVQGA                       405
//

If you have problems or comments...

PBIL Back to PBIL home page